DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and Gyc89Db

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster


Alignment Length:297 Identity:79/297 - (26%)
Similarity:124/297 - (41%) Gaps:73/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   793 CMMLITMYAKERQSEFNTKMNYKLNLDLQNKQKSADVTNQSIIILLNNILPSHVVEVYLSSIAKH 857
            |..|..|:.||.|.          :.:|:...:.||...:....||.:::|..:.|....|   .
  Fly   432 CSKLEIMFEKEEQR----------SDELEKSLELADSWKRQGDELLYSMIPRPIAERMRKS---E 483

  Fly   858 ELYYENYRMVSVMFAML--------TNFQMDLPSLRVLNDIITAFD-RLLSAYKQYYVVEKIKVV 913
            |...:::..|||:|..:        .|.|..:.::..||.:.:|.| .::|.:     |.|::.|
  Fly   484 EHVCQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPF-----VYKVETV 543

  Fly   914 GCTYMAACGLDFSLIENLDSNSNFGSTSLSSELEQVRSRLESSIKEKNHDEVAFIMATFALDLMR 978
            |..|||..|.                                       .:|..:.|..|.||  
  Fly   544 GMVYMAVSGA---------------------------------------PDVNPLHAEHACDL-- 567

  Fly   979 VLSVCNKAYAGEPFDRALSTGEIRIGISTGQIMAGVVGASQPHYDIWGNPVNMASRMESTGLSGH 1043
            .|.|..|..|     .||....||:||::|.::|||||...|.|.::|:.||.||||||:.....
  Fly   568 ALRVMKKVKA-----HALPGVAIRVGINSGPVVAGVVGMKVPRYCLFGDTVNTASRMESSSDPWM 627

  Fly  1044 IQVTKETAQTLEEFDVMCYYRGLTFVKGRGEIPTYFV 1080
            ||::..||..:::.......||...|||:||:.||::
  Fly   628 IQLSNYTALKVQKVGYKVEARGFVKVKGKGEMETYWL 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831
CYCc 262..464 CDD:214485
Nucleotidyl_cyc_III 306..489 CDD:299850
CYCc 831..1055 CDD:214485 61/232 (26%)
Nucleotidyl_cyc_III 859..1080 CDD:299850 64/229 (28%)
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 13/56 (23%)
Nucleotidyl_cyc_III 488..665 CDD:416391 64/228 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453988
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.