DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and CG33958

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster


Alignment Length:274 Identity:81/274 - (29%)
Similarity:126/274 - (45%) Gaps:56/274 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   814 YKLNLDLQNKQKSADVTNQSIIILLNNILPSHVVEVYLSSIAKHELYYENYRMVSVMFAMLTNF- 877
            |.|||..:.|:...: ..:|..:|...:.||..:::..:.....||    |..|::.|:.:..| 
  Fly   445 YALNLSQKAKELKRE-KRKSDSLLFQMLPPSVAMQLKQTQQVPAEL----YEAVTIYFSDIVGFT 504

  Fly   878 --QMDLPSLRV---LNDIITAFDRLLSAYKQYYVVEKIKVVGCTYMAACGLDFSLIENLDSNSNF 937
              ..|...|.|   ||.|...||..:..|..|    |::.:|.:||.|.||.   ::|       
  Fly   505 EIAADCTPLEVVTFLNSIYRVFDERIECYDVY----KVETIGDSYMVASGLP---VKN------- 555

  Fly   938 GSTSLSSELEQVRSRLESSIKEKNHDEVAFIMATFALDLMRVLSVCNKAYAGEPFDRALSTGEIR 1002
            |:..:|.                        :||.||||:...||.....||:.|      .:||
  Fly   556 GNKHISE------------------------IATMALDLLDASSVFRIPRAGDEF------VQIR 590

  Fly  1003 IGISTGQIMAGVVGASQPHYDIWGNPVNMASRMESTGLSGHIQVTKETAQTLEEF-DVMCYYRGL 1066
            .|:.||.::||:||...|.|.::|:.||.||||||||.:..|.:|:|...:|::. .....:|||
  Fly   591 CGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGL 655

  Fly  1067 TFVKGRGEIPTYFV 1080
            ..|||:|.:.||::
  Fly   656 IDVKGKGLMSTYWL 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831
CYCc 262..464 CDD:214485
Nucleotidyl_cyc_III 306..489 CDD:299850
CYCc 831..1055 CDD:214485 66/229 (29%)
Nucleotidyl_cyc_III 859..1080 CDD:299850 71/227 (31%)
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 9/34 (26%)
CYCc 459..647 CDD:214485 67/236 (28%)
Guanylate_cyc 485..669 CDD:278633 72/231 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.