DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and GUCY2D

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_000171.1 Gene:GUCY2D / 3000 HGNCID:4689 Length:1103 Species:Homo sapiens


Alignment Length:410 Identity:96/410 - (23%)
Similarity:148/410 - (36%) Gaps:124/410 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   766 FQYAFIFEHSVTTS-PYLKAEIAHS------------CR----------VCMMLITMYAKERQSE 807
            |..|.|.:..|..| ||...|:...            ||          .|::|:.....| |.|
Human   730 FSLAIIMQEVVCRSAPYAMLELTPEEVVQRVRSPPPLCRPLVSMDQAPVECILLMKQCWAE-QPE 793

  Fly   808 FNTKMN---------------------------YKLNLD--LQNKQKSADVTNQSIIILLNNILP 843
            ....|:                           |..||:  ::.:.:..::..|....||..:||
Human   794 LRPSMDHTFDLFKNINKGRKTNIIDSMLRMLEQYSSNLEDLIRERTEELELEKQKTDRLLTQMLP 858

  Fly   844 SHVVEVYLSSIAKHELYYEN---YRMVSVMFAMLTNFQMDLPSLRVLNDIITAFDRLLSAYKQYY 905
            ..|.|...:.......|:|.   |....|.|..::.....:..:.:|||:.|.||.::.::..| 
Human   859 PSVAEALKTGTPVEPEYFEQVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVY- 922

  Fly   906 VVEKIKVVGCTYMAACGLDFSLIENLDSNSNFGSTSLSSELEQVRSRLESSIKEKNHDEVAFIMA 970
               |::.:|..||.|.||                                  .::|....|..:|
Human   923 ---KVETIGDAYMVASGL----------------------------------PQRNGQRHAAEIA 950

  Fly   971 TFALDLMRVLSVCNKAYAGEPFDRALSTGEIRIGISTGQIMAGVVGASQPHYDIWGNPVNMASRM 1035
            ..:||::..:......:..|...|      ||||:.:|..:|||||.:.|.|.::|:.||.||||
Human   951 NMSLDILSAVGTFRMRHMPEVPVR------IRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRM 1009

  Fly  1036 ESTGLSGHIQVTKETAQTLEEFD--VMCYYRGLTFVKGRGEIPTYFV----GIDKDLKFMSKKID 1094
            |||||...|.|...|...|...|  .....||.|.:||:|...|:::    |.:|.:        
Human  1010 ESTGLPYRIHVNLSTVGILRALDSGYQVELRGRTELKGKGAEDTFWLVGRRGFNKPI-------- 1066

  Fly  1095 RLSENPSNPDL-----NHDL 1109
                 |..|||     ||.:
Human  1067 -----PKPPDLQPGSSNHGI 1081

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831
CYCc 262..464 CDD:214485
Nucleotidyl_cyc_III 306..489 CDD:299850
CYCc 831..1055 CDD:214485 60/226 (27%)
Nucleotidyl_cyc_III 859..1080 CDD:299850 62/225 (28%)
GUCY2DNP_000171.1 PBP1_sensory_GC_DEF-like 55..431 CDD:380594
PK_GC-2D 536..811 CDD:270945 16/81 (20%)
HNOBA <820..865 CDD:369471 10/44 (23%)
CYCc 846..1036 CDD:214485 62/233 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1065..1103 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.