DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and GUCY1B1

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:XP_011530203.1 Gene:GUCY1B1 / 2983 HGNCID:4687 Length:662 Species:Homo sapiens


Alignment Length:237 Identity:69/237 - (29%)
Similarity:114/237 - (48%) Gaps:34/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 LLDSILPPQIAKPIQKSIKEKIIQPDNDFYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTT 326
            ||.|:|||.:|               |:..|       :..:..:.:::|:||::.:|.:....:
Human   436 LLYSVLPPSVA---------------NELRH-------KRPVPAKRYDNVTILFSGIVGFNAFCS 478

  Fly   327 TLT----VEKLVKVLHDLYARFDLAALSFK---VQRIKFLGDCYYCVAGLGESDPDHATMAVSLG 384
            ...    ..|:|.:|:|||.|||....|.|   |.:::.:||.|..|:||.|....||.....|.
Human   479 KHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLA 543

  Fly   385 ISMIANIKEVSVNRSLNIGMRIGVHSGTLFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHV 449
            :.|:....:|.|:.. ::.:.||:|:|.:..||||:...:|.::|..||:.||.|.||..|.::|
Human   544 LDMMEIAGQVQVDGE-SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINV 607

  Fly   450 SGRTLSSLNAEEYNIYPGTESAQKDPVL---QKHPMSTYLLT 488
            |..|...|.:.| |..|......:.||.   :|.||..:.|:
Human   608 SEYTYRCLMSPE-NSDPQFHLEHRGPVSMKGKKEPMQVWFLS 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 8/28 (29%)
CYCc 262..464 CDD:214485 61/208 (29%)
Nucleotidyl_cyc_III 306..489 CDD:299850 60/193 (31%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
GUCY1B1XP_011530203.1 HNOB 2..166 CDD:311572
HNOBA 207..449 CDD:311573 8/27 (30%)
Guanylate_cyc 455..648 CDD:306677 59/194 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.