DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and Gucy1b2

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:XP_011243363.2 Gene:Gucy1b2 / 239134 MGIID:2660873 Length:829 Species:Mus musculus


Alignment Length:542 Identity:110/542 - (20%)
Similarity:209/542 - (38%) Gaps:135/542 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ERLWEQSYLKARCKELHLE-EEYMKYKIRLMISSLTVFVPMLILLIVALQVIIWSFTEYTKYIYI 88
            ||||.:..:.......|:. :|.::.|...:  ::..:||.::.....|.       ||...::.
Mouse   373 ERLWIEEEVFCNAFPFHVVFDEALRVKQAGV--NIQKYVPGILTQKFGLD-------EYFSIVHP 428

  Fly    89 NAIFDLGSLILVTGLLSINFFEDFVIRHR-------WVMTFTSTLSAYVVVLGDIAFNTYYYYKS 146
            ...|::.|:...     ||  ..|:::.|       |....|..|...::.:..:.         
Mouse   429 QVTFNISSICKF-----IN--SQFILKTRREMMPEAWKSQPTLKLRGQMIWMESLK--------- 477

  Fly   147 NWPLNTLYDVFVLCMIYMFLPIPSSKAAALLAISVSLTYVIYFIHFMAFNEHNVAKYVHGLDIVS 211
                         ||::|..|    |..:|..:..|.      :|......|:..:     |:: 
Mouse   478 -------------CMVFMCSP----KLRSLQELEESK------MHLSDIAPHDTTR-----DLI- 513

  Fly   212 IDFFHYLGFNMMGIFFRIMND----TMVRSSFLDRYQFITEEI-----WLRQARRQESLLLDSIL 267
                             ::|.    .|..|..|::.:   ||:     .|...:::...||.::|
Mouse   514 -----------------LLNQQRLAEMELSCQLEKKK---EELRVLSNHLAIEKKKTETLLYAML 558

  Fly   268 PPQIAKPIQKSIKEKIIQPDNDFYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTTLTVEK 332
            |..:|..:::                |....|..|      ...:||::|:|.:|.:.......:
Mouse   559 PEHVANQLKE----------------GKKVAAGEF------ETCTILFSDVVTFTNICAACEPIQ 601

  Fly   333 LVKVLHDLYARFDLAALSFKVQRIKFLGDCYYCVAGLGESDPDHATMAVSLGISMIANIKEVSVN 397
            :|.:|:.:|::||.......|.:::.:||.|..|.|:......||....:..:.|..:.|||   
Mouse   602 IVNMLNSMYSKFDRLTNIHDVYKVETIGDAYMVVGGVPVPVESHAQRVANFALGMRISAKEV--- 663

  Fly   398 RSLN------IGMRIGVHSGTLFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRTLSS 456
              :|      |.:|:|:|:|.:.|||:|....:|.::|..||.|||:|:.|.|..||:|.....:
Mouse   664 --MNPVTGEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAHRA 726

  Fly   457 LNAEEYNIYPGTESAQKDPVLQKHPMSTYLLTAIPSLDSDKTISIVEGVPNLDLQTVGSNRKSQI 521
            |..:.:.|....|...|.    |..|:||.|  |.:|::.: :.|:.....|......|..::|:
Mouse   727 LENKGFEIVTRGEIEVKG----KGKMTTYFL--IRNLNATE-VEIMGRPSALADGKEASTPRNQV 784

  Fly   522 LKPNL----LSHEMREEFRKMP 539
            .||..    :.|..::.:...|
Mouse   785 KKPRAVLSNMDHHQQQVYNSDP 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 38/265 (14%)
CYCc 262..464 CDD:214485 54/207 (26%)
Nucleotidyl_cyc_III 306..489 CDD:299850 54/188 (29%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
Gucy1b2XP_011243363.2 HNOB 115..276 CDD:400167
HNOBA 380..566 CDD:400168 39/259 (15%)
Guanylate_cyc 572..754 CDD:306677 56/198 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.