DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and Npr2

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_776149.1 Gene:Npr2 / 230103 MGIID:97372 Length:1047 Species:Mus musculus


Alignment Length:237 Identity:66/237 - (27%)
Similarity:124/237 - (52%) Gaps:30/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 IMNDTMVR-SSFLDRYQFITEE---IWLRQARRQESLLLDSILPPQIAKPIQKSIKEKIIQPDND 289
            |:::.::| ..:.:..:.:.||   .:|.:.|:.|:||. .|||..:|:.:::            
Mouse   797 ILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLY-QILPHSVAEQLKR------------ 848

  Fly   290 FYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLAALSFKVQ 354
                |.:..||.|      :.|:|.::|:|.:|.|:...|..::|.:|:|||..||....:|.|.
Mouse   849 ----GETVQAEAF------DSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVY 903

  Fly   355 RIKFLGDCYYCVAGL-GESDPDHATMAVSLGISMIANIKEVSVNRSLN--IGMRIGVHSGTLFAG 416
            :::.:||.|..|:|| |.:...||.....:.::::..:....:....:  :.:|||||:|.:.||
Mouse   904 KVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAG 968

  Fly   417 VIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRTLSSLN 458
            |:|....:|.::|..||.|||:|:.|....:|||..|..:|:
Mouse   969 VVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALD 1010

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 13/65 (20%)
CYCc 262..464 CDD:214485 58/200 (29%)
Nucleotidyl_cyc_III 306..489 CDD:299850 49/156 (31%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
Npr2NP_776149.1 PBP1_NPR_B 26..421 CDD:380607
PK_GC-A_B 518..792 CDD:270944
HNOBA <798..846 CDD:369471 12/48 (25%)
CYCc 825..1009 CDD:214485 60/206 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.