DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gcy-36

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_510557.3 Gene:gcy-36 / 191657 WormBaseID:WBGene00001556 Length:675 Species:Caenorhabditis elegans


Alignment Length:373 Identity:97/373 - (26%)
Similarity:158/373 - (42%) Gaps:94/373 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 VLVVCFQYAFIFEHSVTTSPYLKAEIAHSCRVCMMLI-------TMYAKERQSEFNTKMNYKL-- 816
            ::.:|..|       ||:.|.|   :.:..|:..|.|       .:..::|.|:  .:||.:|  
 Worm   348 IMYLCSPY-------VTSIPEL---LQYGLRLTAMPIHDPTRDLILLNQQRLSD--VEMNLQLEA 400

  Fly   817 -NLDLQNKQKSADVTNQSIIILLNNILPSHVVEVYLSSIAKHELYYENYRMVSVMFAMLTNFQMD 880
             |..|:|..|..:|.......||..:||..|.:.....::.....||.   .:|||..:..||..
 Worm   401 NNEQLENMAKDLEVEKGKTDALLREMLPPSVAQQLKQGLSVEAREYEE---ATVMFTDVPTFQQI 462

  Fly   881 LP------SLRVLNDIITAFDRLLSAYKQYYVVEKIKVVGCTYMAACGLDFSLIENLDSNSNFGS 939
            :|      .:.:||::.|.||||:...|.|    |::.||.:||:..|:. .|::          
 Worm   463 VPLCTPKDIVHLLNELFTKFDRLIGIQKAY----KVETVGDSYMSVGGIP-DLVD---------- 512

  Fly   940 TSLSSELEQVRSRLESSIKEKNHDEVAFIMATFALDL-MRVLSVCNKAYAGEPFDRALSTGEIRI 1003
                                 :|.||   :...||.: |...:||: .....|.       .||.
 Worm   513 ---------------------DHCEV---ICHLALGMVMEARTVCD-PITNTPL-------HIRA 545

  Fly  1004 GISTGQIMAGVVGASQPHYDIWGNPVNMASRMESTGLSGHIQVTKETAQTLE-----EFDVMCYY 1063
            ||.:|.::||||||..|.|.::|:.||.:|||||....|.|..::...:..|     ||:.    
 Worm   546 GIHSGPVVAGVVGAKMPRYCLFGDTVNTSSRMESHSPIGRIHCSENAKKCAESTGRFEFEP---- 606

  Fly  1064 RGLTFVKGRGEIPTYFVGIDKDLKFMSKKIDRLSENPSNPDLNHDLDG 1111
            ||...:||:||:.|||:     |:...:.|..:.:...:.:.| .:||
 Worm   607 RGRVQIKGKGEMNTYFL-----LRSFKRSIWEIIDRRRDENCN-SIDG 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831
CYCc 262..464 CDD:214485
Nucleotidyl_cyc_III 306..489 CDD:299850
CYCc 831..1055 CDD:214485 61/230 (27%)
Nucleotidyl_cyc_III 859..1080 CDD:299850 67/232 (29%)
gcy-36NP_510557.3 HNOB 3..167 CDD:285002
HNOBA 217..435 CDD:285003 24/98 (24%)
CYCc 415..604 CDD:214485 62/238 (26%)
Guanylate_cyc 441..624 CDD:278633 68/241 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.