DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gcy-34

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_506319.1 Gene:gcy-34 / 191656 WormBaseID:WBGene00001554 Length:686 Species:Caenorhabditis elegans


Alignment Length:363 Identity:88/363 - (24%)
Similarity:152/363 - (41%) Gaps:84/363 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 VLVVCFQYAFIFEHSVTTSPYLKAEIAHSCRVCMMLITMYAKERQSEFNTKMNYKLNLD-LQNKQ 824
            ::.:|..|.......:.....|.|...|.....::|:.   ::|.|:....:..:.|.: |:...
 Worm   354 IIYLCSPYVTSINELMQFGMRLTAMPLHDATRDLILLN---QQRLSDVEVNLQLEANNEQLETMT 415

  Fly   825 KSADVTNQSIIILLNNILPSHVVEVYLSSIAKHELYYENYRMVSVMFAMLTNFQMDLP------S 883
            ...:|..|....:|.::||..:.:..||........||    .:|||..|..||..:|      .
 Worm   416 HELEVERQKTDSILKDMLPRKIAKQLLSGEHLEPCEYE----ATVMFCDLPAFQQIIPVCQPKNI 476

  Fly   884 LRVLNDIITAFDRLLSAYKQYYVVEKIKVVGCTYMAACGL-DFSLIENLDSNSNFGSTSLSSELE 947
            :::||::....||::.....|    |::.|..:||...|: |::                     
 Worm   477 VKLLNEVFFKLDRIVVLRGVY----KVETVSDSYMTVSGIPDYT--------------------- 516

  Fly   948 QVRSRLESSIKEKNHDEVAFIMATFALDLM----RVLSVCNKAYAGEPFDRALSTGEIRIGISTG 1008
                           .|.|..|...||.:|    .|:...||.    ||       .:|||:.:|
 Worm   517 ---------------SEHAENMCHVALGMMWEARSVMDPVNKT----PF-------LLRIGLHSG 555

  Fly  1009 QIMAGVVGASQPHYDIWGNPVNMASRMESTGLSGHIQVTKET-AQTLE----EFDVMCYYRGLTF 1068
            .|:|||||...|.|.::|..|.:||:|||.|::|.||.:..| ::.:|    ||..    ||...
 Worm   556 TIIAGVVGTKMPRYCLFGETVTLASQMESLGVAGKIQCSSWTYSKAMETGRFEFSP----RGRIN 616

  Fly  1069 VKGRGEIPTYFVGIDKDLKFMSKKIDRLSENPSNPDLN 1106
            |||||::.|||:     ::.:.|.|..::::..:.::|
 Worm   617 VKGRGDVETYFL-----MRSLKKSIWEITDHERDVNVN 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831
CYCc 262..464 CDD:214485
Nucleotidyl_cyc_III 306..489 CDD:299850
CYCc 831..1055 CDD:214485 61/235 (26%)
Nucleotidyl_cyc_III 859..1080 CDD:299850 67/236 (28%)
gcy-34NP_506319.1 HNOB 3..167 CDD:285002
HNOBA 224..441 CDD:285003 15/89 (17%)
CYCc 421..609 CDD:214485 62/242 (26%)
Guanylate_cyc 453..629 CDD:278633 67/239 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.