DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gcy-23

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_500309.3 Gene:gcy-23 / 191652 WormBaseID:WBGene00001548 Length:1073 Species:Caenorhabditis elegans


Alignment Length:268 Identity:66/268 - (24%)
Similarity:134/268 - (50%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 DTMVRSSFLDRYQFITEEI------WLRQARRQESLLLDSILPPQIAKPIQKSIKEKIIQPDNDF 290
            |.|:|  .:::|....|::      .|.:|..:...||..:||..:|..::              
 Worm   816 DQMMR--MMEQYANNLEKLVAERTGMLEEANVRADKLLGQLLPKYVANELK-------------- 864

  Fly   291 YHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLAALSFKVQR 355
              :|.|..|:.|      :..:::::|:|.:|.:.::.|..::|.:|:.:|::||.|.......:
 Worm   865 --MGRSVPAKTF------DMATVMFSDIVGFTTICSSSTPLEVVSMLNSIYSKFDDAINKHGSYK 921

  Fly   356 IKFLGDCYYCVAGLGESD-PDHATMAVSLGISMIANIK--EVSVNRSLNIGMRIGVHSGTLFAGV 417
            ::.:||.|..|:|:.|.: .:|.....:..:.::..:|  |:...|::.:.:|:|:|:||:.|||
 Worm   922 VETIGDAYMIVSGIPEENGNEHIRNICNTALELMLLLKTYEIPHRRNVKLRIRLGIHTGTVAAGV 986

  Fly   418 IGKAKLQYDIWGADVNIASRLEATGSPGYVHVS--GRTLSSLNAEEYNI-YPGTESAQKDPVLQK 479
            :|....:|.::|..||:|||:|:|..|..:.:|  .|........|:.| ..||..|:     .|
 Worm   987 VGLTAPRYCLFGDTVNVASRMESTSEPEKIQMSQEARDFCVRYYSEFQITLRGTVEAK-----GK 1046

  Fly   480 HPMSTYLL 487
            .|:::|.|
 Worm  1047 GPVTSYWL 1054

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 12/64 (19%)
CYCc 262..464 CDD:214485 51/206 (25%)
Nucleotidyl_cyc_III 306..489 CDD:299850 50/188 (27%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
gcy-23NP_500309.3 Periplasmic_Binding_Protein_Type_1 38..407 CDD:299141
ANF_receptor 38..385 CDD:279440
PK_GC 509..806 CDD:270894
HNOBA <817..863 CDD:285003 11/47 (23%)
CYCc 842..1035 CDD:214485 52/214 (24%)
Guanylate_cyc 869..1056 CDD:278633 52/197 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.