DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gcy-15

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_001364713.1 Gene:gcy-15 / 191648 WormBaseID:WBGene00001541 Length:1104 Species:Caenorhabditis elegans


Alignment Length:255 Identity:68/255 - (26%)
Similarity:119/255 - (46%) Gaps:45/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 RIMNDTMVRSSFLDRYQFITEEIWLRQARRQESL---------LLDSILPPQIAKPIQKSIKEKI 283
            |.:.|.||  |.:::|   |:::....|.|.|.|         ||..:||..:|           
 Worm   828 RTIMDNMV--SMIEKY---TDKLEKDIAERNEELEAEKAKSEALLKMMLPEVVA----------- 876

  Fly   284 IQPDNDFYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLAA 348
                 |...||::.:||:|      .:.::.::|...:.:::.|.....:|:.|:|||..||...
 Worm   877 -----DSLKLGSNVSAESF------ENCTVFFSDCPGFVEMSATSKPIDIVQFLNDLYTVFDRII 930

  Fly   349 LSFKVQRIKFLGDCYYCVAGLGESDPD-HATMAVSLGISMIANIKEVSVNRSLN--IGMRIGVHS 410
            ..|.|.:::.:.|.|...:||...:.: ||....|||::::..::...:....|  :.:|||::|
 Worm   931 DQFDVYKVETIADAYMVASGLPVPNGNHHAGEIASLGLALLKAVESFKIRHLPNEKVRLRIGMNS 995

  Fly   411 GTLFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRT------LSSLNAEEYNI 464
            |...|||:|....:|.::|..||.|||:|:.|.|..::.||..      |.....||..|
 Worm   996 GPCVAGVVGLKMPRYCLFGDTVNTASRMESNGIPLRINCSGTAKEILDQLGGYEIEERGI 1055

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 17/71 (24%)
CYCc 262..464 CDD:214485 56/210 (27%)
Nucleotidyl_cyc_III 306..489 CDD:299850 46/168 (27%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
gcy-15NP_001364713.1 Periplasmic_Binding_Protein_type1 2..363 CDD:415822
PK_GC 553..822 CDD:270894
HNOBA <831..879 CDD:400168 16/68 (24%)
Guanylate_cyc 885..1071 CDD:306677 49/177 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.