DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gcy-14

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_506660.2 Gene:gcy-14 / 191647 WormBaseID:WBGene00001540 Length:1111 Species:Caenorhabditis elegans


Alignment Length:330 Identity:85/330 - (25%)
Similarity:147/330 - (44%) Gaps:49/330 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 FNMMGIFFRIMNDTMVRSSFLDRYQFITEEIWLRQARRQESLLLDSILPPQIAKPIQKSIKEKII 284
            |||:..:...:.:.:     .||.:.:.||      :::..:||..:||..:|            
 Worm   816 FNMLETYASTLEEEV-----SDRTKELVEE------KKKSDVLLYRMLPKMVA------------ 857

  Fly   285 QPDNDFYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLAAL 349
                |...||.:...|.|      ..|:|.::|:|.:|.|....|..::|.:|:|||..||....
 Worm   858 ----DKLKLGQTVEPETF------EQVTIFFSDVVQFTTLAGKCTPLQVVTLLNDLYTIFDGIIE 912

  Fly   350 SFKVQRIKFLGDCYYCVAGL-GESDPDHATMAVSLGISMIANIKEVSVNR--SLNIGMRIGVHSG 411
            ...|.:::.:||.|.||:|| ..:..:|......:.:..:::::...|..  |..|.:|||::.|
 Worm   913 QNDVYKVETIGDGYLCVSGLPHRNGNEHIRHIARMSLGFLSSLEFFRVQHLPSERINLRIGINCG 977

  Fly   412 TLFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRTLSSLNAEEYNIYPG--TESAQKD 474
            ::.|||:|....:|.::|..||.|||:|:.|.||.:||:......|.    .:..|  |||..:.
 Worm   978 SVVAGVVGLTMPRYCLFGDAVNTASRMESNGKPGKIHVTAEANQMLT----QVVGGFRTESRGEV 1038

  Fly   475 PVLQKHPMSTYLLTAIPSLDSDKTISIVEGVPNLDLQTVGSNRKSQILKPNLLSHEMREEFRKMP 539
            .:..|..|.||.|     |.....||:....|.  .:|....|:..:...:.:..:|.||.:|..
 Worm  1039 IIKGKGVMETYWL-----LGEQSRISVSAQAPR--EKTPEPPRRQSVRSISPIIEKMSEETQKGL 1096

  Fly   540 VGGFK 544
            ...:|
 Worm  1097 YSAYK 1101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 13/70 (19%)
CYCc 262..464 CDD:214485 58/204 (28%)
Nucleotidyl_cyc_III 306..489 CDD:299850 57/187 (30%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
gcy-14NP_506660.2 PBP1_NPR_GC_like 21..423 CDD:107347
ANF_receptor 43..418 CDD:279440
PKc_like 535..800 CDD:304357
HNOBA <817..860 CDD:285003 12/69 (17%)
CYCc 839..1031 CDD:214485 61/223 (27%)
Guanylate_cyc 866..1053 CDD:278633 59/201 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.