DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gcy-13

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_506097.3 Gene:gcy-13 / 191646 WormBaseID:WBGene00001539 Length:1028 Species:Caenorhabditis elegans


Alignment Length:276 Identity:82/276 - (29%)
Similarity:137/276 - (49%) Gaps:43/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 NMMGIFFRIMNDTMVRSSFLDRYQFITEEIWLRQARRQESLLLDSILPPQIAKPIQKSIKEKIIQ 285
            |:|...|.::...  .||..|..|...:|  |.:.:::..:||..:||.|:|:.::         
 Worm   779 NLMDHVFSVLEKH--ASSLEDEVQERMKE--LVEEKKKSDILLYRMLPQQVAERLK--------- 830

  Fly   286 PDNDFYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLAAL- 349
                   ||.|...|.|.|      |:|.::|:|.:|.|....|..::|.:|:|||..|| |.: 
 Worm   831 -------LGQSVEPEAFES------VTIFFSDVVGFTVLANKSTPLQVVNLLNDLYTTFD-AIIE 881

  Fly   350 ---SFKVQRIKFLGDCYYCVAGL-GESDPDHATMAVSLGISMIANIKEVSVNR--SLNIGMRIGV 408
               |:||:.|   ||.|..|:|| ..:..:|.....::.:.::.:::...:..  ...:.:|||:
 Worm   882 KNDSYKVETI---GDAYLVVSGLPRRNGTEHVANIANMSLELMDSLQAFKIPHLPQEKVQIRIGM 943

  Fly   409 HSGTLFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRTLSSLNA--EEYNIYPGTESA 471
            |||:..|||:|....:|.::|..||.|||:|:.|.||::|:|......|.:  :|||    |||.
 Worm   944 HSGSCVAGVVGLTMPRYCLFGDTVNTASRMESNGKPGFIHLSSDCYDLLTSLYKEYN----TESR 1004

  Fly   472 QKDPVLQKHPMSTYLL 487
            .:..:..|..|.||.|
 Worm  1005 GEVIIKGKGVMQTYWL 1020

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 15/69 (22%)
CYCc 262..464 CDD:214485 64/210 (30%)
Nucleotidyl_cyc_III 306..489 CDD:299850 61/191 (32%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
gcy-13NP_506097.3 PBP1_NPR_GC_like 3..397 CDD:107347
ANF_receptor 13..368 CDD:279440
PKc_like 548..770 CDD:304357
HNOBA <797..829 CDD:285003 10/33 (30%)
CYCc 808..1000 CDD:214485 63/217 (29%)
Guanylate_cyc 835..1022 CDD:278633 64/200 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.