DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gcy-4

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_496218.2 Gene:gcy-4 / 191642 WormBaseID:WBGene00001531 Length:1136 Species:Caenorhabditis elegans


Alignment Length:264 Identity:70/264 - (26%)
Similarity:131/264 - (49%) Gaps:36/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 TEEIWLRQARRQESLLLDSILPPQIAKPIQKSIKEKIIQPDNDFYHLGTSRTAENFMSIQIHNDV 311
            |:|:.|.  :::..:||..:||.|:|:.::..   :.::|             |:|      :.|
 Worm   850 TKELTLE--KKKSDILLGRMLPKQVAERLKAG---QAVEP-------------ESF------DLV 890

  Fly   312 SILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLAALSFKVQRIKFLGDCYYCVAGL-GESDPD 375
            ::.::|||.:|.|.:..:..::|.:|:|:::.||.......|.:::.:||.:.||:|| ..:..:
 Worm   891 TVFFSDLVKFTDLASKCSPFQVVNLLNDVFSNFDSIIEKHDVYKVESIGDGFLCVSGLPNRNGME 955

  Fly   376 HATMAVSLGISMI---ANIKEVSVNRSLNIGMRIGVHSGTLFAGVIGKAKLQYDIWGADVNIASR 437
            |....|.:.:..:   .|.:...:.|. .:.:|:|::||...|||:|.:..:|.::|..||.|||
 Worm   956 HIRQIVGMSLCFMEFCRNFRIPHLPRE-RVELRVGINSGPCVAGVVGLSMPRYCLFGDTVNTASR 1019

  Fly   438 LEATGSPGYVHVSGRTLSSLNAEEYNIYP---GTESAQKDPVLQKHPMSTYLLTAIPSLDSDKTI 499
            :|:.|.|..:|:|....|.|    .|.||   .|.|..:..:..|..|.||.|....||.:..|.
 Worm  1020 MESNGKPSMIHMSEAAHSLL----VNNYPYQFETNSRGEVIIKGKGVMETYWLLGKMSLSNQSTP 1080

  Fly   500 SIVE 503
            .|.:
 Worm  1081 PITK 1084

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 10/43 (23%)
CYCc 262..464 CDD:214485 53/205 (26%)
Nucleotidyl_cyc_III 306..489 CDD:299850 54/189 (29%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
gcy-4NP_496218.2 PBP1_NPR_GC_like 29..457 CDD:107347
ANF_receptor 49..423 CDD:279440
PKc_like 558..819 CDD:304357
HNOBA <834..876 CDD:285003 9/27 (33%)
CYCc 855..1047 CDD:214485 57/220 (26%)
Guanylate_cyc 882..1070 CDD:278633 57/211 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.