DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gcy-1

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_496039.1 Gene:gcy-1 / 191639 WormBaseID:WBGene00001528 Length:1137 Species:Caenorhabditis elegans


Alignment Length:326 Identity:82/326 - (25%)
Similarity:154/326 - (47%) Gaps:48/326 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 NMMGIFFRIMNDTMVRSSFLDRYQFITEEIWLRQARRQESLLLDSILPPQIAKPIQKSIKEKIIQ 285
            |:|...|.::.:  ..|:..:..:..|:|:.|.  :::..:||..:||.|:|:.::..   :.::
 Worm   833 NLMDHVFNMLEE--YTSTLEEEIEERTKELTLE--KKKADILLSRMLPKQVAERLKAG---QTVE 890

  Fly   286 PDNDFYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLAALS 350
            |             |.|      :.|::.::|:|.:|.|.:..:..:.|.:|:|||:.||.....
 Worm   891 P-------------EGF------DSVTVFFSDVVKFTILASKCSPFQTVNLLNDLYSNFDTIIEQ 936

  Fly   351 FKVQRIKFLGDCYYCVAGL-GESDPDHATMAVSLGISMIANIKEVSVNR--SLNIGMRIGVHSGT 412
            ..|.:::.:||.|.||:|| ..:...|....|.:.:..:...|..::..  ..|:.:||||:||.
 Worm   937 HGVYKVESIGDGYLCVSGLPTRNGYAHIKQIVDMSLKFMEYCKSFNIPHLPRENVELRIGVNSGP 1001

  Fly   413 LFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRTLSSLNAEEYNIYPGTESAQKDPVL 477
            ..|||:|.:..:|.::|..||.|||:|:.|.|..:|::....|.|.....|.|   |::.:..|:
 Worm  1002 CVAGVVGLSMPRYCLFGDTVNTASRMESNGKPSLIHLTNDAHSLLTTHYPNQY---ETSSRGEVI 1063

  Fly   478 --QKHPMSTYLL---------TAIPSLDSDKTISIVEG--VPNLDLQTVGSNRKSQILKPNLLSH 529
              .|..|.|:.:         |.:.|:.:..|..:...  :|| ...:.|| |.|.:..| |..|
 Worm  1064 IKGKGVMETFWVHGRFGEMEPTELRSISNRSTPPVTNDRWIPN-PSSSHGS-RPSSVYDP-LQGH 1125

  Fly   530 E 530
            :
 Worm  1126 Q 1126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 14/69 (20%)
CYCc 262..464 CDD:214485 56/204 (27%)
Nucleotidyl_cyc_III 306..489 CDD:299850 54/196 (28%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
gcy-1NP_496039.1 PBP1_NPR_GC_like 35..449 CDD:107347
ANF_receptor 53..432 CDD:279440
PKc_like 555..821 CDD:304357
HNOBA <840..883 CDD:285003 10/46 (22%)
CYCc 862..1051 CDD:214485 57/212 (27%)
Guanylate_cyc 889..1077 CDD:278633 57/209 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.