DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gcy-20

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_507101.1 Gene:gcy-20 / 184797 WormBaseID:WBGene00001545 Length:1108 Species:Caenorhabditis elegans


Alignment Length:316 Identity:87/316 - (27%)
Similarity:143/316 - (45%) Gaps:54/316 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 FNMMGIFFRIMNDTMVRSSFLDRYQFITEEIWLRQARRQESLLLDSILPPQIAKPIQKSIKEKII 284
            |||:..:...:.:.:     .||.:.:|||      :::..:||..:||..:|            
 Worm   817 FNMLETYASTLEEEV-----SDRTKELTEE------KKKSDVLLYRMLPRMVA------------ 858

  Fly   285 QPDNDFYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLAAL 349
                |...||.:...|.|      ..|:|.::|:|.:|.|....|..::|.:|:|||..||....
 Worm   859 ----DKLKLGQTVEPETF------EQVTIFFSDVVQFTTLAGKCTPLQVVTLLNDLYTIFDGIIE 913

  Fly   350 SFKVQRIKFLGDCYYCVAGL-GESDPDHATMAVSLGISMIANIKEVSVNR--SLNIGMRIGVHSG 411
            ...|.:::.:||.|.||:|| ..:..||......:.:..:::::...|..  :..|.:|||::.|
 Worm   914 QNDVYKVETIGDGYLCVSGLPHRNGNDHIRHIARMSLGFLSSLEFFRVQHLPAERINLRIGINCG 978

  Fly   412 TLFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRTLSSLNAEEYNIYPG--TESAQKD 474
            ::.|||:|....:|.::|..||.|||:|:.|.||.:||:......|.    .:..|  |||..:.
 Worm   979 SVVAGVVGLTMPRYCLFGDAVNTASRMESNGKPGQIHVTAEANRMLT----QVVGGFRTESRGEV 1039

  Fly   475 PVLQKHPMSTYLL-------TAIPSLDSDKTI----SIVEGVPNLDLQTVGSNRKS 519
            .:..|..|.|:.|       || ||..:.|.|    ||....|.|:....||...|
 Worm  1040 IIKGKGVMETFWLLGEESGYTA-PSKAAPKVIQHRQSIRSISPILEKNAEGSETSS 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 14/70 (20%)
CYCc 262..464 CDD:214485 58/204 (28%)
Nucleotidyl_cyc_III 306..489 CDD:299850 56/194 (29%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
gcy-20NP_507101.1 PBP1_NPR_GC_like 22..439 CDD:107347
ANF_receptor 44..418 CDD:279440
PKc_like 536..801 CDD:304357
STYKc 562..801 CDD:214568
HNOBA <818..861 CDD:285003 13/69 (19%)
CYCc 840..1032 CDD:214485 61/223 (27%)
Guanylate_cyc 867..1054 CDD:278633 58/196 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.