DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gcy-32

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_506452.5 Gene:gcy-32 / 179887 WormBaseID:WBGene00001552 Length:684 Species:Caenorhabditis elegans


Alignment Length:371 Identity:93/371 - (25%)
Similarity:147/371 - (39%) Gaps:100/371 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 VLVVCFQYAFIFEHSVTTSPYLKAEIAHSCRVCMMLITMYAKERQSEFNTKMNYKLNLD-LQNKQ 824
            ::.:|..|.......:.....|.|...|.....::|:.   ::|.|:....:..:.|.: |:...
 Worm   353 IIYLCSPYVTSINELMQYGMRLTAMPLHDATRDLILLN---QQRLSDVEVNLQLEANNEQLETMT 414

  Fly   825 KSADVTNQSIIILLNNILPSHVVEVYLS----SIAKHELYYENYRMVSVMFAMLTNFQMDLPS-- 883
            :..::..|....:|.::||..:.:..||    ...:||        .:|||..|..||..:|.  
 Worm   415 RELELERQKTDSILKDMLPRRIAQQLLSGEHIEACEHE--------ATVMFCDLPAFQQAIPQCS 471

  Fly   884 ----LRVLNDIITAFDRLLSAYKQYYVVEKIKVVGCTYMAACGL-DFSLIENLDSNSNFGSTSLS 943
                :.:||:|....||::.....|    |::.|..:|||..|: |::                 
 Worm   472 PKDIVNMLNEIFRKLDRIVVIRGVY----KVETVSDSYMAVSGIPDYT----------------- 515

  Fly   944 SELEQVRSRLESSIKEKNHDEVAFIMATFALDLM----RVLSVCNKAYAGEPFDRALSTGEIRIG 1004
                               .|.|..|...||.:|    .|:...:|.    ||       .:|||
 Worm   516 -------------------PEHAENMCHVALGMMWEARSVIDPVSKT----PF-------LLRIG 550

  Fly  1005 ISTGQIMAGVVGASQPHYDIWGNPVNMASRMESTGLSGHIQVTKETAQ-TLE----EFDVMCYYR 1064
            |.:|.|.|||||...|.|.::|..|.:||:|||.|::|.||.:|...| .:|    ||..    |
 Worm   551 IHSGTITAGVVGTVHPKYCLFGETVTLASQMESLGMAGKIQCSKWAYQKAMETGRFEFSP----R 611

  Fly  1065 GLTFVKGRGEIPTYFVGIDKDLKFMSKKIDRLSENPSNPDLNHDLD 1110
            |...||.||...|||  :.:.||   |.|..:        ::||.|
 Worm   612 GRIDVKQRGLTETYF--LTRSLK---KSIWEI--------IDHDRD 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831
CYCc 262..464 CDD:214485
Nucleotidyl_cyc_III 306..489 CDD:299850
CYCc 831..1055 CDD:214485 64/239 (27%)
Nucleotidyl_cyc_III 859..1080 CDD:299850 67/236 (28%)
gcy-32NP_506452.5 HNOB 3..167 CDD:285002
HNOBA 226..440 CDD:285003 14/89 (16%)
CYCc 419..608 CDD:214485 65/247 (26%)
Guanylate_cyc 452..627 CDD:278633 69/239 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.