DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gcy-18

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_502449.2 Gene:gcy-18 / 178237 WormBaseID:WBGene00001543 Length:1113 Species:Caenorhabditis elegans


Alignment Length:296 Identity:68/296 - (22%)
Similarity:137/296 - (46%) Gaps:44/296 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 MNDTMV---RSSFLDRYQFITEEI-------------WLRQARRQESLLLDSILPPQIAKPIQKS 278
            :|..||   :.|.:|:...:.|:.             .|.:|..:...||..:||..:|..::  
 Worm   842 LNTEMVLKTKGSLVDQMMKMMEQYANNLEKLVAERTGMLEEANIRADQLLTQLLPAYVANELK-- 904

  Fly   279 IKEKIIQPDNDFYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTTLTVEKLVKVLHDLYAR 343
                          :|.|      ::.::::..:||::|:|.:|.:.:..|..::|.:|:.||..
 Worm   905 --------------MGRS------VAPKLYSSATILFSDIVGFTTICSGSTPLEVVNMLNGLYTG 949

  Fly   344 FDLAALSFKVQRIKFLGDCYYCVAGL-GESDPDHATMAVSLGISMIANIK--EVSVNRSLNIGMR 405
            ||......|..:::.:||.|..|:|: .|::.:|:....:..:.|...:.  ::....:..:..|
 Worm   950 FDECITRNKSYKVETIGDAYMVVSGIPEENEYNHSRNIANTALDMRQYLTGYQIPHRPTHRVRCR 1014

  Fly   406 IGVHSGTLFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRTLSSLNAEEYNIYPGTES 470
            .|.|:|::.|||:|....:|.::|..||::||:|:||:||.:.:|......:.| .:.::..||.
 Worm  1015 WGFHTGSVAAGVVGLTCPRYCLFGDTVNVSSRMESTGTPGMIQMSEEAHMHIRA-HHPVFTTTER 1078

  Fly   471 AQKDPVLQKHPMSTYLL-TAIPSLDSDKTISIVEGV 505
            .:.. |..|....|:.| ..:....:...|..||||
 Worm  1079 GEVQ-VKGKGTCRTFWLEDRVGDASTTNYIQNVEGV 1113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 13/76 (17%)
CYCc 262..464 CDD:214485 49/204 (24%)
Nucleotidyl_cyc_III 306..489 CDD:299850 48/186 (26%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
gcy-18NP_502449.2 Periplasmic_Binding_Protein_Type_1 87..448 CDD:299141
ANF_receptor 87..395 CDD:279440
PKc_like 549..846 CDD:304357 1/3 (33%)
HNOBA <857..903 CDD:285003 8/45 (18%)
CYCc 882..1073 CDD:214485 50/213 (23%)
Guanylate_cyc 909..1095 CDD:278633 47/187 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.