DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gucy1b1

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:XP_004911214.1 Gene:gucy1b1 / 100379900 XenbaseID:XB-GENE-950986 Length:618 Species:Xenopus tropicalis


Alignment Length:277 Identity:73/277 - (26%)
Similarity:129/277 - (46%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 MVRSSFLDRYQFITEEIWLRQARRQESL------------LLDSILPPQIAKPIQKSIKEKIIQP 286
            ::...|.:.|: :|:|:.:...|.|.:|            ||.|:|||.:|              
 Frog   354 LLGEQFREEYK-LTQELEILTDRLQHTLRALEDEKKKTDTLLYSVLPPSVA-------------- 403

  Fly   287 DNDFYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTTLT----VEKLVKVLHDLYARFDLA 347
             |:..|       :..:..:.:::|:||::.:|.:....:...    ..|:|.:|:|:|.|||:.
 Frog   404 -NELRH-------KRPVPAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDIL 460

  Fly   348 ALSFK---VQRIKFLGDCYYCVAGLGESDPDHATMAVSLGISMIANIKEVSVNRSLNIGMRIGVH 409
            ..|..   |.:::.:||.|..|:|:.|....||.....|.:.|:....:|.|:.. ::.:.||:|
 Frog   461 TDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQVDGE-SVQITIGIH 524

  Fly   410 SGTLFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRTLSSLNAEEYNIYPGTESAQKD 474
            :|.:..||||:...:|.::|..||:.||.|.||..|.::||..|...|.:.| |..|......:.
 Frog   525 TGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPE-NSDPQFHLQYRG 588

  Fly   475 PVLQK---HPMSTYLLT 488
            ||..|   .||..:.|:
 Frog   589 PVSMKGKTDPMQVWFLS 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 15/68 (22%)
CYCc 262..464 CDD:214485 58/208 (28%)
Nucleotidyl_cyc_III 306..489 CDD:299850 57/193 (30%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
gucy1b1XP_004911214.1 HNOB 2..166 CDD:377902
HNOBA 207..406 CDD:369471 15/67 (22%)
Guanylate_cyc 412..605 CDD:306677 56/194 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.