DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gucy1b1

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_001238874.1 Gene:gucy1b1 / 100150304 ZFINID:ZDB-GENE-090313-160 Length:608 Species:Danio rerio


Alignment Length:277 Identity:76/277 - (27%)
Similarity:132/277 - (47%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 MVRSSFLDRYQFITEEIWLRQARRQESL------------LLDSILPPQIAKPIQKSIKEKIIQP 286
            ::...|.:.|: :|:|:.:...|.|.:|            ||.|:|||.:|              
Zfish   354 LLGEQFREEYK-LTQELEILTDRLQHTLRALEDEKKKTDRLLYSVLPPSVA-------------- 403

  Fly   287 DNDFYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTT-LTVE---KLVKVLHDLYARFDLA 347
             |:..|       :..:..:.:::|:||::.:|.:....:. .:.|   |:|.:|:|:|.|||:.
Zfish   404 -NELRH-------KRPVPAKRYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTRFDIL 460

  Fly   348 ALSFK---VQRIKFLGDCYYCVAGLGESDPDHATMAVSLGISMIANIKEVSVNRSLNIGMRIGVH 409
            ..|.|   |.:::.:||.|..|:||.|....||.....|.:.|:....:|.|:.. .:.:.||:|
Zfish   461 TDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQVKVDED-PVQITIGIH 524

  Fly   410 SGTLFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRTLSSLNAEEYNIYPGTESAQKD 474
            :|.:..||||:...:|.::|..||:.||.|.||..|.::||..|...|.:.| |..|......:.
Zfish   525 TGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSVE-NADPQFHLEYRG 588

  Fly   475 PVL---QKHPMSTYLLT 488
            ||.   :|.||..:.|:
Zfish   589 PVTMKGKKEPMKVWFLS 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 15/68 (22%)
CYCc 262..464 CDD:214485 61/208 (29%)
Nucleotidyl_cyc_III 306..489 CDD:299850 60/193 (31%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
gucy1b1NP_001238874.1 HNOB 2..166 CDD:285002
HNOBA 207..406 CDD:285003 15/67 (22%)
CYCc 385..584 CDD:214485 63/222 (28%)
Guanylate_cyc 412..605 CDD:278633 59/194 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.