DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and RPN14

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_011511.3 Gene:RPN14 / 852880 SGDID:S000002972 Length:417 Species:Saccharomyces cerevisiae


Alignment Length:309 Identity:72/309 - (23%)
Similarity:120/309 - (38%) Gaps:92/309 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NYTLKFTL-AGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSS 124
            |:.|:..: ..|...::.:||.|:||.|.|||.|..:|||...||...:|:.||:..::|:|...
Yeast   124 NFNLQREIDQAHVSEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIID 188

  Fly   125 DSRLLVSGSDDKTLKVWELSTGKSLKT-------------------------------------- 151
            ..|.::|.|.|.|:::||..||.::.|                                      
Yeast   189 RGRNVLSASLDGTIRLWECGTGTTIHTFNRKENPHDGVNSIALFVGTDRQLHEISTSKKNNLEFG 253

  Fly   152 ------LKGHSNYV------------------FCCNFNP------QSNLIVSGSFDESVRIWDVR 186
                  :.||.:.|                  |.|:.|.      .:|.|.:|..:..:..||:|
Yeast   254 TYGKYVIAGHVSGVITVHNVFSKEQTIQLPSKFTCSCNSLTVDGNNANYIYAGYENGMLAQWDLR 318

  Fly   187 TGKCL--KTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKF 249
            :.:|.  :.|.....|::.|:| ..|:|.|||.:|...:: |..|..      :.:.|.:.|.  
Yeast   319 SPECPVGEFLINEGTPINNVYF-AAGALFVSSGFDTSIKL-DIISDP------ESERPAIEFE-- 373

  Fly   250 SPNGKYILAATLDNTLKLW----DYSKGKCLKTYTGHKNEKYCIFANFS 294
            :|.   .|.:..|...:..    |.|.|:.|:  .|..|  :|...|.|
Yeast   374 TPT---FLVSNDDEVSQFCYVSDDESNGEVLE--VGKNN--FCALYNLS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 71/306 (23%)
WD40 repeat 75..112 CDD:293791 16/36 (44%)
WD40 repeat 118..154 CDD:293791 12/79 (15%)
WD40 repeat 159..195 CDD:293791 11/61 (18%)
WD40 repeat 202..237 CDD:293791 10/34 (29%)
WD40 repeat 244..280 CDD:293791 8/39 (21%)
WD40 repeat 288..325 CDD:293791 3/7 (43%)
WD40 repeat 331..357 CDD:293791
RPN14NP_011511.3 WD40 repeat 96..133 CDD:293791 2/8 (25%)
WD40 133..>357 CDD:421866 54/224 (24%)
WD40 repeat 140..176 CDD:293791 16/35 (46%)
WD40 repeat 181..217 CDD:293791 12/35 (34%)
WD40 repeat 227..283 CDD:293791 3/55 (5%)
WD40 repeat 290..328 CDD:293791 8/37 (22%)
WD40 repeat 335..378 CDD:293791 13/55 (24%)
WD40 repeat 385..412 CDD:293791 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.