Sequence 1: | NP_001245503.1 | Gene: | wds / 53428 | FlyBaseID: | FBgn0040066 | Length: | 361 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011511.3 | Gene: | RPN14 / 852880 | SGDID: | S000002972 | Length: | 417 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 309 | Identity: | 72/309 - (23%) |
---|---|---|---|
Similarity: | 120/309 - (38%) | Gaps: | 92/309 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 NYTLKFTL-AGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSS 124
Fly 125 DSRLLVSGSDDKTLKVWELSTGKSLKT-------------------------------------- 151
Fly 152 ------LKGHSNYV------------------FCCNFNP------QSNLIVSGSFDESVRIWDVR 186
Fly 187 TGKCL--KTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKF 249
Fly 250 SPNGKYILAATLDNTLKLW----DYSKGKCLKTYTGHKNEKYCIFANFS 294 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
wds | NP_001245503.1 | WD40 | 64..358 | CDD:238121 | 71/306 (23%) |
WD40 repeat | 75..112 | CDD:293791 | 16/36 (44%) | ||
WD40 repeat | 118..154 | CDD:293791 | 12/79 (15%) | ||
WD40 repeat | 159..195 | CDD:293791 | 11/61 (18%) | ||
WD40 repeat | 202..237 | CDD:293791 | 10/34 (29%) | ||
WD40 repeat | 244..280 | CDD:293791 | 8/39 (21%) | ||
WD40 repeat | 288..325 | CDD:293791 | 3/7 (43%) | ||
WD40 repeat | 331..357 | CDD:293791 | |||
RPN14 | NP_011511.3 | WD40 repeat | 96..133 | CDD:293791 | 2/8 (25%) |
WD40 | 133..>357 | CDD:421866 | 54/224 (24%) | ||
WD40 repeat | 140..176 | CDD:293791 | 16/35 (46%) | ||
WD40 repeat | 181..217 | CDD:293791 | 12/35 (34%) | ||
WD40 repeat | 227..283 | CDD:293791 | 3/55 (5%) | ||
WD40 repeat | 290..328 | CDD:293791 | 8/37 (22%) | ||
WD40 repeat | 335..378 | CDD:293791 | 13/55 (24%) | ||
WD40 repeat | 385..412 | CDD:293791 | 7/30 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |