DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and AT1G56030

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001319249.1 Gene:AT1G56030 / 842054 AraportID:AT1G56030 Length:391 Species:Arabidopsis thaliana


Alignment Length:124 Identity:29/124 - (23%)
Similarity:47/124 - (37%) Gaps:40/124 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 ELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHF 206
            |::..|..|.|:|..|.:..| |..|.||      ...|..|..:           .|..|::..
plant   227 EIALDKERKELEGIKNLLETC-FTGQKNL------KSQVITWKDK-----------YDQGSSIRK 273

  Fly   207 NRDGSLI-----------VSSSY----DGLCRIWDTASGQCLKT---LIDDDNPPVSFV 247
            .::.:|.           ::.||    |.:.:..|.|    |||   ::|:..||.||:
plant   274 EKEVALSTKKLELEIFKQLAGSYKQDADAMRQERDNA----LKTVQEIVDEQQPPPSFI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 29/124 (23%)
WD40 repeat 75..112 CDD:293791
WD40 repeat 118..154 CDD:293791 4/11 (36%)
WD40 repeat 159..195 CDD:293791 7/35 (20%)
WD40 repeat 202..237 CDD:293791 10/52 (19%)
WD40 repeat 244..280 CDD:293791 2/4 (50%)
WD40 repeat 288..325 CDD:293791
WD40 repeat 331..357 CDD:293791
AT1G56030NP_001319249.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D957291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.