DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and PUB54

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_171674.2 Gene:PUB54 / 839251 AraportID:AT1G01680 Length:308 Species:Arabidopsis thaliana


Alignment Length:168 Identity:36/168 - (21%)
Similarity:58/168 - (34%) Gaps:47/168 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 FEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSL-------KTLKGH---SNYVF 160
            |..|.|..:|..|::....||.|  :.|.:...|..::...|.:       ..:.||   ...|.
plant    41 FSLTTSSSRLEQSEIDAIQDSEL--NTSVNSLYKYRDICINKGVNEKDVDTSMISGHDVGEGIVE 103

  Fly   161 CCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSL------IVSSSYD 219
            ....|..:||::.                      |.:||    |::|..|:      .||....
plant   104 LIYQNIITNLVMG----------------------AAADP----HYSRGMSITSRKAEYVSQHAP 142

  Fly   220 GLCRIWDTASGQCLKTLIDD---DNPPVSFVKFSPNGK 254
            ..|:||....|:.:|.....   .||..||.:||.:.:
plant   143 HSCKIWFICKGKLIKQRERSFYLGNPSDSFSEFSTSAE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 36/168 (21%)
WD40 repeat 75..112 CDD:293791 2/5 (40%)
WD40 repeat 118..154 CDD:293791 7/42 (17%)
WD40 repeat 159..195 CDD:293791 4/35 (11%)
WD40 repeat 202..237 CDD:293791 10/40 (25%)
WD40 repeat 244..280 CDD:293791 4/11 (36%)
WD40 repeat 288..325 CDD:293791
WD40 repeat 331..357 CDD:293791
PUB54NP_171674.2 STK_N 5..153 CDD:238947 28/139 (20%)
RING-Ubox_WDSUB1_like 237..278 CDD:319569
U-box domain, a modified RING finger 239..277 CDD:319569
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D957291at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.