DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and AT1G24530

DIOPT Version :10

Sequence 1:NP_524984.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_564219.1 Gene:AT1G24530 / 839068 AraportID:AT1G24530 Length:418 Species:Arabidopsis thaliana


Alignment Length:199 Identity:64/199 - (32%)
Similarity:97/199 - (48%) Gaps:37/199 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SVKPNYTLKF----------TLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEK--- 108
            ||..:.|||.          ::..|..||:|:..|.||. :.:.|||:.|::|....|  ||   
plant   210 SVSWDKTLKIWRASDLRCKESIKAHDDAVNAIAVSTNGT-VYTGSADRRIRVWAKPTG--EKRHT 271

  Fly   109 ---TISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLK----TLKGHSNYVFCCNFNP 166
               |:..||..::.:|.:.|..:|.|||.|:::.|||.....:..    .|:||...:... || 
plant   272 LVATLEKHKSAVNALALNDDGSVLFSGSCDRSILVWEREDTSNYMAVRGALRGHDKAILSL-FN- 334

  Fly   167 QSNLIVSGSFDESVRIWDVRTG-----KCLKTLPAHSDPVSAVHFNRDGSL-----IVSSSYDGL 221
            .|:|::|||.|.:||||  |.|     .||:.|..|:.||.::...|:..|     |:|.|.||.
plant   335 VSDLLLSGSADRTVRIW--RRGPDSSYSCLEVLSGHTKPVKSLAAVREKELDDVVSIISGSLDGE 397

  Fly   222 CRIW 225
            .:.|
plant   398 VKCW 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_524984.1 WD40 <63..361 CDD:441893 62/193 (32%)
WD40 repeat 75..112 CDD:293791 14/42 (33%)
WD40 repeat 118..154 CDD:293791 11/39 (28%)
WD40 repeat 159..195 CDD:293791 16/40 (40%)
WD40 repeat 202..237 CDD:293791 8/29 (28%)
WD40 repeat 244..280 CDD:293791
WD40 repeat 288..325 CDD:293791
WD40 repeat 331..357 CDD:293791
AT1G24530NP_564219.1 WD40 <79..404 CDD:441893 64/199 (32%)
WD40 repeat 86..124 CDD:293791
WD40 repeat 198..233 CDD:293791 5/22 (23%)
WD40 repeat 239..278 CDD:293791 13/41 (32%)
WD40 repeat 283..323 CDD:293791 10/39 (26%)
WD40 repeat 330..366 CDD:293791 16/39 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.