DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and DCAF11

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001156956.1 Gene:DCAF11 / 80344 HGNCID:20258 Length:546 Species:Homo sapiens


Alignment Length:381 Identity:82/381 - (21%)
Similarity:146/381 - (38%) Gaps:113/381 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFE--KTISGHKLG--ISDV 120
            || .|.||.:...||...: :|.:|:...|:..|:.|:::....|:|.  |:|....:|  :.||
Human   162 PN-DLGFTDSYSQKAFCGI-YSKDGQIFMSACQDQTIRLYDCRYGRFRKFKSIKARDVGWSVLDV 224

  Fly   121 AWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNL--------------- 170
            |::.|....:..|       |              |:|:..||...:.:.               
Human   225 AFTPDGNHFLYSS-------W--------------SDYIHICNIYGEGDTHTALDLRPDERRFAV 268

  Fly   171 -----------IVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHF-NRDGSLIVSSSYDGLCR 223
                       ::.|:.|..:.::|....:....:.:|.|.|:||.| :....::.|...|.:|:
Human   269 FSIAVSSDGREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFADISSQILFSGGDDAICK 333

  Fly   224 IWDTASGQCLKTLIDDDNPPV----------SFVKFSPNGKYILAATLDNTLKLWDYSK------ 272
            :||.      :|:.:||..||          :|:....:.:|:::.:.|.|:||||..:      
Human   334 VWDR------RTMREDDPKPVGALAGHQDGITFIDSKGDARYLISNSKDQTIKLWDIRRFSSREG 392

  Fly   273 --------------------------------GKCLKTYTGH---KNEKYCIFANFSVTGGKWIV 302
                                            ...|.||.||   .....|.|:....||.::|.
Human   393 MEASRQAATQQNWDYRWQQVPKKAWRKLKLPGDSSLMTYRGHGVLHTLIRCRFSPIHSTGQQFIY 457

  Fly   303 SGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWK 358
            ||.....|.:::|.|..:|:||..|...|...:.||.|..|.|::.  |..::||:
Human   458 SGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSW--DGNLRLWQ 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 79/375 (21%)
WD40 repeat 75..112 CDD:293791 9/38 (24%)
WD40 repeat 118..154 CDD:293791 6/35 (17%)
WD40 repeat 159..195 CDD:293791 5/61 (8%)
WD40 repeat 202..237 CDD:293791 9/35 (26%)
WD40 repeat 244..280 CDD:293791 11/83 (13%)
WD40 repeat 288..325 CDD:293791 12/36 (33%)
WD40 repeat 331..357 CDD:293791 7/25 (28%)
DCAF11NP_001156956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
WD40 169..511 CDD:330360 76/371 (20%)
WD 1 170..210 9/40 (23%)
WD40 repeat 180..214 CDD:293791 9/33 (27%)
WD 2 216..258 11/62 (18%)
WD40 repeat 221..263 CDD:293791 10/62 (16%)
WD 3 263..302 3/38 (8%)
WD40 repeat 269..305 CDD:293791 3/35 (9%)
WD 4 305..345 13/45 (29%)
WD40 repeat 310..352 CDD:293791 14/47 (30%)
WD 5 353..392 8/38 (21%)
WD40 repeat 359..394 CDD:293791 8/34 (24%)
WD 6 435..480 12/44 (27%)
WD40 repeat 440..470 CDD:293791 8/29 (28%)
WD 7 481..520 10/33 (30%)
WD40 repeat 486..510 CDD:293791 7/25 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 523..546
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.