DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and PAAF1

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001350485.1 Gene:PAAF1 / 80227 HGNCID:25687 Length:393 Species:Homo sapiens


Alignment Length:310 Identity:73/310 - (23%)
Similarity:122/310 - (39%) Gaps:47/310 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PNSVGQPGATTSSNSSASNKSSLSVKPNYTLKFTLAG----HTKA--VSAVKFSPNGEWLASSSA 92
            |...|.....||...|.|:..::.:..|....|....    .||:  :|..|.:.:.::||..:.
Human    23 PRCFGTAWVLTSFFPSYSDLDTVFITSNMIANFCCEPAEWVQTKSIHISCPKENASSKFLAPYTT 87

  Fly    93 DKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSN 157
            ...|                |...|:.:..||...|.||.|.|.|:|:|:.|.|:..:.|:||..
Human    88 FSRI----------------HTKSITCLDISSRGGLGVSSSTDGTMKIWQASNGELRRVLEGHVF 136

  Fly   158 YVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLC 222
            .|.||.|.|...:::||..|..::||......|:.|...|...:........|..:||:|.||..
Human   137 DVNCCRFFPSGLVVLSGGMDAQLKIWSAEDASCVVTFKGHKGGILDTAIVDRGRNVVSASRDGTA 201

  Fly   223 RIWDTASGQCLKTLID-------------DDNPPVSFVKFSPN-------GKYILAATLDNTLKL 267
            |:||.....||..|.|             |::..:...:..|:       .|.:|.|..|..|:.
Human   202 RLWDCGRSACLGVLADCGSSINGVAVGAADNSINLGSPEQMPSEREVGTEAKMLLLAREDKKLQC 266

  Fly   268 WDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQS 317
            ......:.:..:.|......|.|.:     |..:::|::|..:|..:::|
Human   267 LGLQSRQLVFLFIGSDAFNCCTFLS-----GFLLLAGTQDGNIYQLDVRS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 66/280 (24%)
WD40 repeat 75..112 CDD:293791 5/36 (14%)
WD40 repeat 118..154 CDD:293791 13/35 (37%)
WD40 repeat 159..195 CDD:293791 12/35 (34%)
WD40 repeat 202..237 CDD:293791 11/34 (32%)
WD40 repeat 244..280 CDD:293791 6/42 (14%)
WD40 repeat 288..325 CDD:293791 7/30 (23%)
WD40 repeat 331..357 CDD:293791
PAAF1NP_001350485.1 WD40 90..339 CDD:330360 59/243 (24%)
WD40 repeat 96..133 CDD:293791 14/36 (39%)
WD40 repeat 139..175 CDD:293791 11/35 (31%)
WD40 repeat 180..223 CDD:293791 13/42 (31%)
WD40 repeat 232..279 CDD:293791 6/46 (13%)
WD40 repeat 284..318 CDD:293791 7/33 (21%)
WD40 repeat 326..359 CDD:293791
WD40 repeat 366..388 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.