| Sequence 1: | NP_001245503.1 | Gene: | wds / 53428 | FlyBaseID: | FBgn0040066 | Length: | 361 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_076469.1 | Gene: | Apaf1 / 78963 | RGDID: | 620575 | Length: | 1249 | Species: | Rattus norvegicus |
| Alignment Length: | 329 | Identity: | 94/329 - (28%) |
|---|---|---|---|
| Similarity: | 162/329 - (49%) | Gaps: | 31/329 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 46 SNSSASNKSSLSVKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTI 110
Fly 111 SGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSN--LIVS 173
Fly 174 GSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTL-- 236
Fly 237 ----IDDDNPP------VSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNE-KYCIF 290
Fly 291 ANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIK 355
Fly 356 LWKS 359 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| wds | NP_001245503.1 | WD40 | 64..358 | CDD:238121 | 88/308 (29%) |
| WD40 repeat | 75..112 | CDD:293791 | 12/36 (33%) | ||
| WD40 repeat | 118..154 | CDD:293791 | 13/35 (37%) | ||
| WD40 repeat | 159..195 | CDD:293791 | 14/37 (38%) | ||
| WD40 repeat | 202..237 | CDD:293791 | 11/40 (28%) | ||
| WD40 repeat | 244..280 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 288..325 | CDD:293791 | 8/36 (22%) | ||
| WD40 repeat | 331..357 | CDD:293791 | 6/25 (24%) | ||
| Apaf1 | NP_076469.1 | CARD_APAF1 | 7..92 | CDD:260034 | |
| AAA_16 | 126..245 | CDD:289934 | |||
| NB-ARC | 129..414 | CDD:279299 | |||
| WD40 | <598..685 | CDD:225201 | 29/95 (31%) | ||
| WD40 | 607..910 | CDD:238121 | 92/318 (29%) | ||
| WD 1-1 | 613..652 | 15/48 (31%) | |||
| WD40 repeat | 623..655 | CDD:293791 | 11/31 (35%) | ||
| WD40 | 653..1038 | CDD:225201 | 75/265 (28%) | ||
| WD 1-2 | 655..694 | 13/38 (34%) | |||
| WD40 repeat | 661..697 | CDD:293791 | 13/35 (37%) | ||
| WD 1-3 | 697..738 | 15/40 (38%) | |||
| WD40 repeat | 702..740 | CDD:293791 | 14/37 (38%) | ||
| WD 1-4 | 741..780 | 12/38 (32%) | |||
| WD40 repeat | 747..789 | CDD:293791 | 11/41 (27%) | ||
| WD 1-5 | 796..837 | 8/40 (20%) | |||
| WD40 repeat | 801..837 | CDD:293791 | 8/35 (23%) | ||
| WD 1-6 | 838..877 | 11/42 (26%) | |||
| WD40 repeat | 843..882 | CDD:293791 | 10/42 (24%) | ||
| WD 1-7 | 880..910 | 8/31 (26%) | |||
| WD40 repeat | 885..909 | CDD:293791 | 6/25 (24%) | ||
| Interpropeller linker. /evidence=ECO:0000250 | 910..921 | 0/2 (0%) | |||
| WD 2-1 | 922..958 | ||||
| WD 2-2 | 959..998 | ||||
| WD40 | 961..1235 | CDD:238121 | |||
| WD40 | 961..>1235 | CDD:225201 | |||
| WD40 repeat | 964..1001 | CDD:293791 | |||
| WD 2-3 | 1001..1040 | ||||
| WD40 repeat | 1006..1030 | CDD:293791 | |||
| WD 2-4 | 1042..1080 | ||||
| WD40 repeat | 1048..1082 | CDD:293791 | |||
| WD 2-5 | 1083..1122 | ||||
| WD40 repeat | 1089..1124 | CDD:293791 | |||
| WD 2-6 | 1125..1164 | ||||
| WD40 repeat | 1130..1174 | CDD:293791 | |||
| WD 2-7 | 1176..1213 | ||||
| WD40 repeat | 1181..1203 | CDD:293791 | |||
| WD 2-8 | 1214..1249 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||