| Sequence 1: | NP_001245503.1 | Gene: | wds / 53428 | FlyBaseID: | FBgn0040066 | Length: | 361 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_571683.1 | Gene: | apaf1 / 58131 | ZFINID: | ZDB-GENE-000616-4 | Length: | 1261 | Species: | Danio rerio |
| Alignment Length: | 375 | Identity: | 91/375 - (24%) |
|---|---|---|---|
| Similarity: | 154/375 - (41%) | Gaps: | 77/375 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 52 NKSSLSVK-PNYTL----------KFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIW------ 99
Fly 100 --GAYDGKFEKTISGHKLGISDVAWSSDSRLLV-------------------------------- 130
Fly 131 SGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLP 195
Fly 196 AHSDPVSAVHFNRDGSL--IVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILA 258
Fly 259 ATLDNTLKLWDYSKGKCLKTYTGHKN-EKYCIFANFSVTGGKWIVSGSEDNMVYIWNL------- 315
Fly 316 ----QSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSDT 361 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| wds | NP_001245503.1 | WD40 | 64..358 | CDD:238121 | 84/357 (24%) |
| WD40 repeat | 75..112 | CDD:293791 | 15/44 (34%) | ||
| WD40 repeat | 118..154 | CDD:293791 | 13/67 (19%) | ||
| WD40 repeat | 159..195 | CDD:293791 | 11/35 (31%) | ||
| WD40 repeat | 202..237 | CDD:293791 | 11/36 (31%) | ||
| WD40 repeat | 244..280 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 288..325 | CDD:293791 | 6/47 (13%) | ||
| WD40 repeat | 331..357 | CDD:293791 | 6/25 (24%) | ||
| apaf1 | NP_571683.1 | DD | 7..92 | CDD:301326 | |
| NB-ARC | 132..411 | CDD:279299 | |||
| P-loop_NTPase | 150..297 | CDD:304359 | |||
| WD 1 | 615..654 | ||||
| WD40 | 616..912 | CDD:238121 | 21/58 (36%) | ||
| WD40 repeat | 625..657 | CDD:293791 | |||
| WD40 | 641..1042 | CDD:225201 | 49/188 (26%) | ||
| WD 2 | 657..696 | ||||
| WD40 repeat | 663..699 | CDD:293791 | |||
| WD 3 | 700..743 | ||||
| WD40 repeat | 705..745 | CDD:293791 | |||
| WD 4 | 746..785 | ||||
| WD40 repeat | 752..796 | CDD:293791 | |||
| WD 5 | 798..836 | ||||
| WD40 repeat | 803..841 | CDD:293791 | |||
| WD 6 | 840..879 | 7/25 (28%) | |||
| WD40 | 851..1256 | CDD:225201 | 91/375 (24%) | ||
| WD40 | 877..1212 | CDD:238121 | 84/346 (24%) | ||
| WD 7 | 882..921 | 15/38 (39%) | |||
| WD40 repeat | 887..911 | CDD:293791 | 12/23 (52%) | ||
| WD40 repeat | 960..1005 | CDD:293791 | 7/44 (16%) | ||
| WD 8 | 964..1003 | 7/38 (18%) | |||
| WD 9 | 1006..1045 | 13/39 (33%) | |||
| WD40 repeat | 1011..1046 | CDD:293791 | 11/35 (31%) | ||
| WD 10 | 1047..1088 | 14/40 (35%) | |||
| WD 11 | 1091..1130 | 8/39 (21%) | |||
| WD40 repeat | 1096..1132 | CDD:293791 | 8/36 (22%) | ||
| WD 12 | 1133..1172 | 8/42 (19%) | |||
| WD40 repeat | 1138..1162 | CDD:293791 | 4/27 (15%) | ||
| WD 13 | 1184..1223 | 8/38 (21%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||