DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and ahi1

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001306918.1 Gene:ahi1 / 562701 ZFINID:ZDB-GENE-060803-1 Length:1190 Species:Danio rerio


Alignment Length:376 Identity:99/376 - (26%)
Similarity:178/376 - (47%) Gaps:70/376 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GATTSS--NSSASNKSSLSV----------------------KPNYTLK------FTLAGHTKAV 75
            |:|:.|  ||..:||:|..:                      ||.::.:      |||.      
Zfish   495 GSTSYSELNSEMTNKTSTQIQESKAETMKWSRMPGQVCRIPNKPMHSFRGGQMGCFTLC------ 553

  Fly    76 SAVKFSPNGEWLASSSADK---LIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKT 137
                ||.:|..||::.||:   .|.|:....||...:.:||...:.|:.||.|.:.|::.|.|.|
Zfish   554 ----FSHDGRALAAACADRDAFPIIIYEIPSGKVLSSFNGHLSVVYDLCWSRDDKGLLTASSDGT 614

  Fly   138 LKVWELSTGKSL--KTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVR----TGKCLKTLP 195
            ::||.:...::|  |||. |.::|:|..|:||: :|:.:|.:|..:|:|:|.    .|:.|:...
Zfish   615 VRVWNVERLQTLAHKTLP-HPSFVYCAKFHPQAQSLVATGGYDGVLRVWNVDVQDVNGQLLQEFD 678

  Fly   196 AHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDT---------ASGQC-----LKTLIDDDNPPVSF 246
            .|...::.:.|:.:||.:.|:...||..:|.|         |:.|.     :|. .|.:...::.
Zfish   679 GHKTFINTLCFDPEGSRMFSADNSGLIIVWGTKVMPGSRRGATSQWSIEREIKE-ADLNGISINS 742

  Fly   247 VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVY 311
            ::..|||:.:|....|:.|::.|. :...:|.|.|..|.:..|.:.|:.. |.:|.:||||.:.|
Zfish   743 LEVHPNGRRLLIHAKDSVLRVMDL-RILAVKKYIGATNYRDRINSTFTPC-GSFIFAGSEDGLAY 805

  Fly   312 IWNLQSKEVVQKLQG--HTDTVLCTACHPTENIIASAALENDKTIKLWKSD 360
            :||.::.:.|.....  ::..:...|.||.||::|......::.|.|:..|
Zfish   806 VWNSETGDQVAVYSELCYSSALRAVAFHPHENMVAFCCFGQNQPIHLYLYD 856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 88/325 (27%)
WD40 repeat 75..112 CDD:293791 11/39 (28%)
WD40 repeat 118..154 CDD:293791 14/37 (38%)
WD40 repeat 159..195 CDD:293791 13/40 (33%)
WD40 repeat 202..237 CDD:293791 11/48 (23%)
WD40 repeat 244..280 CDD:293791 8/35 (23%)
WD40 repeat 288..325 CDD:293791 12/36 (33%)
WD40 repeat 331..357 CDD:293791 7/25 (28%)
ahi1NP_001306918.1 WD40 486..901 CDD:225201 99/376 (26%)
WD40 540..840 CDD:238121 85/313 (27%)
WD40 repeat 549..589 CDD:293791 14/49 (29%)
WD40 repeat 595..632 CDD:293791 13/36 (36%)
WD40 repeat 637..678 CDD:293791 13/40 (33%)
WD40 repeat 685..729 CDD:293791 10/43 (23%)
WD40 repeat 740..775 CDD:293791 8/35 (23%)
WD40 repeat 783..820 CDD:293791 12/37 (32%)
SH3_AHI-1 1026..1077 CDD:212746
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.