DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and nup37

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_012814496.1 Gene:nup37 / 549511 XenbaseID:XB-GENE-1015893 Length:344 Species:Xenopus tropicalis


Alignment Length:294 Identity:63/294 - (21%)
Similarity:108/294 - (36%) Gaps:66/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLK 139
            |..|:|:|    ..|..|..|:    ||.|.....|:..:....|.|        |.|.:.||||
 Frog    37 VHVVEFNP----FDSGEAGSLL----AYGGISYVVIASCRFQEEDSA--------VEGIEFKTLK 85

  Fly   140 VWELSTGKSLKTLKGHSNYVFCCNFNPQSNL--------IVSGSFDESVRIW--DVRTGKCLKTL 194
            .:.            |...|....::|::..        ..:.:.|:.:||:  |.:.....|.:
 Frog    86 TFH------------HGERVVAIAWSPETRCDALLPLLRFATAAGDKKIRIFTSDFQDKNEYKVI 138

  Fly   195 PAHSDPVSAVHF-NRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKY-IL 257
            ..||..::.:.| :.:||.|.|...|..|||||....|....::   ..|...|.:.|.|.: ::
 Frog   139 EGHSGYINDLVFCSAEGSDIASVGDDHTCRIWDLDGKQIAMFVL---RSPGMSVAWHPEGAFKLM 200

  Fly   258 AATLDNTLKLWDYSKGKCLKTYTGHK----NEKYCIFANF---SVTGGKWIVSGSEDNMVYIWNL 315
            .|....|::.:|.:..:.:.:....:    :..:||....   :|.|..||          ||.:
 Frog   201 VAEKTGTIRFYDLTTHQAILSLESVQVPLMSADWCIRNTLRIGAVAGNDWI----------IWEM 255

  Fly   316 QSKEVVQ-KLQGHTDTVLC---TACHPTENIIAS 345
            ......| ....|.|....   :.|:  ||:.|:
 Frog   256 PRSSYPQDNKPAHADRARLFRWSKCN--ENVFAT 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 63/294 (21%)
WD40 repeat 75..112 CDD:293791 11/36 (31%)
WD40 repeat 118..154 CDD:293791 8/35 (23%)
WD40 repeat 159..195 CDD:293791 7/45 (16%)
WD40 repeat 202..237 CDD:293791 12/35 (34%)
WD40 repeat 244..280 CDD:293791 6/36 (17%)
WD40 repeat 288..325 CDD:293791 9/40 (23%)
WD40 repeat 331..357 CDD:293791 4/18 (22%)
nup37XP_012814496.1 WD40 <77..234 CDD:392136 34/171 (20%)
WD40 repeat 93..139 CDD:293791 7/45 (16%)
WD40 repeat 146..181 CDD:293791 12/34 (35%)
WD40 repeat 186..221 CDD:293791 6/34 (18%)
HTH_42 <191..>325 CDD:388651 20/109 (18%)
WD40 repeat 229..265 CDD:293791 9/45 (20%)
WD40 repeat 272..295 CDD:293791 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.