DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and NLE1

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_060566.2 Gene:NLE1 / 54475 HGNCID:19889 Length:485 Species:Homo sapiens


Alignment Length:416 Identity:106/416 - (25%)
Similarity:171/416 - (41%) Gaps:114/416 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QPNSVGQPGATTSSNSSASNKSSLSVKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIK 97
            ||.::.:..|.|...||                  |.||::||.:|.|||.|::|||.|.|..::
Human    93 QPQAIFRVRAVTRCTSS------------------LEGHSEAVISVAFSPTGKYLASGSGDTTVR 139

  Fly    98 IWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSL-KTLKGHSNYVFC 161
            .|.........|..||:..:..::||.|.|.|.||..:..:.:|:.||||.: :||.|||.::..
Human   140 FWDLSTETPHFTCKGHRHWVLSISWSPDGRKLASGCKNGQILLWDPSTGKQVGRTLAGHSKWITG 204

  Fly   162 CNF-----NPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGL 221
            .::     ||:...:.|.|.|.||||||...|:|.:.|..|:..|:.:.:..|| |:.|:|.|..
Human   205 LSWEPLHANPECRYVASSSKDGSVRIWDTTAGRCERILTGHTQSVTCLRWGGDG-LLYSASQDRT 268

  Fly   222 CRIWDTASGQCLKTL-------------------------------------------------- 236
            .::|....|...:||                                                  
Human   269 IKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEASVNPQDLQGSLQELKERALSRY 333

  Fly   237 --------------IDD----------DNPP----------VSFVKFSPNGKYILAATLDNTLKL 267
                          .||          |..|          ::.|.|||:.:.:.:|:.|.::||
Human   334 NLVRGQGPERLVSGSDDFTLFLWSPAEDKKPLTRMTGHQALINQVLFSPDSRIVASASFDKSIKL 398

  Fly   268 WDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVL 332
            ||...||.|.:..||....|.|..:   ...:.:||||.|:.:.:|:::::::...|.||.|.|.
Human   399 WDGRTGKYLASLRGHVAAVYQIAWS---ADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGHADEVY 460

  Fly   333 CTACHPTENIIASAALENDKTIKLWK 358
            .....|....:||..  .||.:::|:
Human   461 AVDWSPDGQRVASGG--KDKCLRIWR 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 99/383 (26%)
WD40 repeat 75..112 CDD:293791 13/36 (36%)
WD40 repeat 118..154 CDD:293791 14/36 (39%)
WD40 repeat 159..195 CDD:293791 13/40 (33%)
WD40 repeat 202..237 CDD:293791 10/98 (10%)
WD40 repeat 244..280 CDD:293791 13/35 (37%)
WD40 repeat 288..325 CDD:293791 7/36 (19%)
WD40 repeat 331..357 CDD:293791 6/25 (24%)
NLE1NP_060566.2 Ubiquitin-like (UBL) domain. /evidence=ECO:0000250|UniProtKB:P25382 14..96 2/2 (100%)
NLE 17..77 CDD:285380
WD40 106..484 CDD:238121 101/401 (25%)
WD40 107..485 CDD:225201 102/402 (25%)
WD 1. /evidence=ECO:0000255 112..151 15/38 (39%)
WD 2. /evidence=ECO:0000255 154..193 14/38 (37%)
WD40 repeat 159..197 CDD:293791 14/37 (38%)
WD 3. /evidence=ECO:0000255 197..241 16/43 (37%)
WD40 repeat 203..244 CDD:293791 14/40 (35%)
WD 4. /evidence=ECO:0000255 244..282 10/38 (26%)
WD40 repeat 249..284 CDD:293791 10/35 (29%)
WD40 repeat 291..369 CDD:293791 4/77 (5%)
WD 5. /evidence=ECO:0000255 325..366 4/40 (10%)
WD 6. /evidence=ECO:0000255 370..409 13/38 (34%)
WD40 repeat 375..411 CDD:293791 13/35 (37%)
WD 7. /evidence=ECO:0000255 412..451 10/41 (24%)
WD40 repeat 417..453 CDD:293791 8/38 (21%)
WD 8. /evidence=ECO:0000255 454..485 10/33 (30%)
WD40 repeat 459..483 CDD:293791 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.