DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and CG7568

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster


Alignment Length:433 Identity:108/433 - (24%)
Similarity:156/433 - (36%) Gaps:140/433 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PPQQPLPTAPSGPNSLQPNSVGQPGATTSSNSSASNKSSLS---------VKPNYTLKFTLAGHT 72
            ||.:|:    ||       ||.:     |.|:.::.|.:|.         ||..:.|......|.
  Fly    70 PPPRPV----SG-------SVAR-----SQNAFSALKQALEKLQKKLREPVKKKFYLHKCHNSHI 118

  Fly    73 KAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGH-----KLGISDVAW-------SSD 125
            ..::.|.|..:||...:.|.|:...:......:.|..:|||     .:|.:...|       .|.
  Fly   119 LPLTNVSFDRSGERCLTGSYDRTCHVINTQTAQVEHILSGHDNVVFSVGFNFPHWLVYLQSGGSG 183

  Fly   126 SRL----------LVSGSDDKTLKVWELSTGKSLKTLKGHS------------------------ 156
            :.|          :|:||.|.|.|||..::|:||.|..||:                        
  Fly   184 NNLTTFSIIFSDKIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIATASLDGS 248

  Fly   157 -------------------NYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVS 202
                               ..|....||....::::||||.|..|||||:......|..||..:|
  Fly   249 ARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKSLGHQLRGHSAELS 313

  Fly   203 AVHFNRDGSLIVSSSYDGLCRIWDT-----------------------ASGQCLKTLIDD----- 239
            ...:|..||||.:.|.|...|||||                       |:||.|.|...|     
  Fly   314 NCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARV 378

  Fly   240 -----------------DNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKY 287
                             .:..||.|.|||:|..:|.|:.|||.:||....|:|.:...||:.|.:
  Fly   379 WRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQVLAGHEGEVF 443

  Fly   288 -CIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTD 329
             |.::    ..|..|::.|:||....|. .....||...|..|
  Fly   444 SCAYS----YAGDAILTASKDNSCRFWRXYDWYTVQLNDGSID 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 95/377 (25%)
WD40 repeat 75..112 CDD:293791 7/36 (19%)
WD40 repeat 118..154 CDD:293791 15/52 (29%)
WD40 repeat 159..195 CDD:293791 13/35 (37%)
WD40 repeat 202..237 CDD:293791 18/57 (32%)
WD40 repeat 244..280 CDD:293791 16/35 (46%)
WD40 repeat 288..325 CDD:293791 9/36 (25%)
WD40 repeat 331..357 CDD:293791
CG7568NP_001263071.1 WD40 93..466 CDD:225201 93/376 (25%)
WD40 repeat 122..158 CDD:293791 7/35 (20%)
WD40 154..467 CDD:238121 81/316 (26%)
WD40 repeat 189..222 CDD:293791 12/32 (38%)
WD40 repeat 228..265 CDD:293791 0/36 (0%)
WD40 repeat 270..306 CDD:293791 13/35 (37%)
WD40 repeat 314..348 CDD:293791 12/33 (36%)
WD40 repeat 355..393 CDD:293791 6/37 (16%)
WD40 repeat 400..436 CDD:293791 16/35 (46%)
WD40 repeat 442..466 CDD:293791 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.