DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and Nup37

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001262950.1 Gene:Nup37 / 43040 FlyBaseID:FBgn0039301 Length:320 Species:Drosophila melanogaster


Alignment Length:307 Identity:63/307 - (20%)
Similarity:118/307 - (38%) Gaps:56/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PNSVGQPGATTSSNSSASNK-----SSLSVKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSAD 93
            |...|:.|.|...:.....|     |:|:..|:.:|..|              ||...|.:::..
  Fly    48 PEESGEFGYTRLQDMDLGEKEQRSVSALAFSPDTSLNCT--------------PNNVTLCAANGS 98

  Fly    94 KLIKIWGAYDGKFE--KTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHS 156
            :| |::....|:|.  :.:.||...::||:|..|..||.|.|||.|.:.|..:.|.......|.|
  Fly    99 QL-KLYRTDLGQFTSLQVLRGHGDYVNDVSWVCDGELLASVSDDFTCRFWTTTGGGENVITFGLS 162

  Fly   157 NYVFCCNFNPQS-NLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDG 220
            :.......:|:. |.::.......:.:::|...:.:.::.:...|:.:..:.....|.::|...|
  Fly   163 SAGMSVKSHPEDPNKVLVAEKKGIIHLYNVTLKQTVISVESPKFPLMSADWAHSNRLFITSLAGG 227

  Fly   221 LCRIWDTASGQCLKTLIDDDNPPV-----SFVKFSP-NGKYILAATLDNTLKLWDYSK-----GK 274
            ....||..     :..:..|...|     ..|:|:| :.:.::|..:..|||::....     ..
  Fly   228 DVVTWDLN-----RPYVPADVKQVHEDCGRVVRFAPGSSEMVIAMVIGLTLKVFAAKSTVPLLEA 287

  Fly   275 CLKTYTG---HKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSK 318
            .||:|.|   |:...|              :|...|..:..|.:|.|
  Fly   288 SLKSYGGMAWHQRLPY--------------ISAVSDRKLLFWKVQMK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 55/272 (20%)
WD40 repeat 75..112 CDD:293791 7/38 (18%)
WD40 repeat 118..154 CDD:293791 13/35 (37%)
WD40 repeat 159..195 CDD:293791 3/36 (8%)
WD40 repeat 202..237 CDD:293791 5/34 (15%)
WD40 repeat 244..280 CDD:293791 10/46 (22%)
WD40 repeat 288..325 CDD:293791 5/31 (16%)
WD40 repeat 331..357 CDD:293791
Nup37NP_001262950.1 WD40 71..320 CDD:295369 57/282 (20%)
WD40 <71..318 CDD:225201 56/280 (20%)
WD40 repeat 72..118 CDD:293791 12/60 (20%)
WD40 repeat 124..160 CDD:293791 13/35 (37%)
WD40 repeat 165..202 CDD:293791 3/36 (8%)
WD40 repeat 209..245 CDD:293791 6/40 (15%)
WD40 repeat 252..286 CDD:293791 7/33 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.