| Sequence 1: | NP_001245503.1 | Gene: | wds / 53428 | FlyBaseID: | FBgn0040066 | Length: | 361 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_017176434.1 | Gene: | Wdr95 / 381693 | MGIID: | 1923042 | Length: | 1099 | Species: | Mus musculus |
| Alignment Length: | 321 | Identity: | 69/321 - (21%) |
|---|---|---|---|
| Similarity: | 124/321 - (38%) | Gaps: | 79/321 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 73 KAVSAVKFSPNGEWLASSSADKLIKIWGAY-DGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDK 136
Fly 137 TLKVWELST-------GKSLKTLKG---------------------------------------H 155
Fly 156 SNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCL-KTLPAHSDP-VSAVHFNRDGSLIVSSSY 218
Fly 219 DGLCRIWDTASGQCLKTLIDDDNP----PVSFVKFSPNGKYILAATLDNTLKLW-----DYSKGK 274
Fly 275 CLKTY------TGHKNEKYCI-----FANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKL 324 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| wds | NP_001245503.1 | WD40 | 64..358 | CDD:238121 | 69/321 (21%) |
| WD40 repeat | 75..112 | CDD:293791 | 10/37 (27%) | ||
| WD40 repeat | 118..154 | CDD:293791 | 10/42 (24%) | ||
| WD40 repeat | 159..195 | CDD:293791 | 12/36 (33%) | ||
| WD40 repeat | 202..237 | CDD:293791 | 11/34 (32%) | ||
| WD40 repeat | 244..280 | CDD:293791 | 4/46 (9%) | ||
| WD40 repeat | 288..325 | CDD:293791 | 9/42 (21%) | ||
| WD40 repeat | 331..357 | CDD:293791 | |||
| Wdr95 | XP_017176434.1 | EF-hand_8 | 125..178 | CDD:372744 | |
| WD40 | 450..758 | CDD:238121 | 64/309 (21%) | ||
| WD40 repeat | 462..498 | CDD:293791 | 9/35 (26%) | ||
| WD40 repeat | 504..544 | CDD:293791 | 10/39 (26%) | ||
| WD40 repeat | 549..584 | CDD:293791 | 0/34 (0%) | ||
| WD40 repeat | 592..627 | CDD:293791 | 11/34 (32%) | ||
| WD40 repeat | 635..671 | CDD:293791 | 11/35 (31%) | ||
| WD40 repeat | 679..727 | CDD:293791 | 4/48 (8%) | ||
| WD40 repeat | 734..757 | CDD:293791 | 4/31 (13%) | ||
| WD40 repeat | 787..832 | CDD:293791 | |||
| WD40 | 799..>939 | CDD:225201 | |||
| WD40 repeat | 840..883 | CDD:293791 | |||
| WD40 repeat | 892..916 | CDD:293791 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||