DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and Wdr81

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster


Alignment Length:252 Identity:53/252 - (21%)
Similarity:105/252 - (41%) Gaps:54/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NKSSLSVKPNYTLKF------TLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAY---DGK-- 105
            |:::.:.|...||..      :..|||.:|.|:....|.....|:|.||.:|:|...   ||:  
  Fly  1632 NETTRNEKDTQTLNLKQIRLQSFVGHTNSVRAIYALDNENSFISASKDKTVKLWSLRSEGDGRKT 1696

  Fly   106 --FEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKG--HSNYVFCCNFNP 166
              .:.|.:.||..|:.:.:....|.:|  |.|..:.:|:...|:.|..|..  ||..........
  Fly  1697 SACQFTYTAHKKSINSLGFLESLRYVV--SCDSGIHLWDPFIGRPLSVLDAPRHSAVTVVKCLPS 1759

  Fly   167 QSNLIVSGSFDESVRIWDVR------------------TGKCLKTLPAHSDPVSAVHFNRDGSLI 213
            .|.|:::|:.:.:|::.|.|                  |.:||...|:             |:.:
  Fly  1760 HSPLVIAGTAESTVKMVDARSCEYVNEWRVCNASLPNATVRCLAVAPS-------------GNWL 1811

  Fly   214 VSSSYDGLCRIWDTASGQCLKTL--IDDDNPPVSFVKFSPNGKYILAATLDNTLKLW 268
            .:....|.....||.:|..:.:.  ::.|...::    :|:.::::::.||::|.:|
  Fly  1812 AAGLSSGCIVQLDTRTGMVINSWRPMECDLLQLA----APSDQFLVSSALDHSLAVW 1864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 50/240 (21%)
WD40 repeat 75..112 CDD:293791 12/43 (28%)
WD40 repeat 118..154 CDD:293791 8/35 (23%)
WD40 repeat 159..195 CDD:293791 9/53 (17%)
WD40 repeat 202..237 CDD:293791 5/36 (14%)
WD40 repeat 244..280 CDD:293791 5/25 (20%)
WD40 repeat 288..325 CDD:293791
WD40 repeat 331..357 CDD:293791
Wdr81NP_609535.1 Beach 345..588 CDD:100117
WD40 <1644..1877 CDD:225201 50/240 (21%)
WD40 1651..1876 CDD:295369 49/233 (21%)
WD40 repeat 1662..1705 CDD:293791 11/42 (26%)
WD40 repeat 1710..1744 CDD:293791 8/35 (23%)
WD40 repeat 1752..1788 CDD:293791 6/35 (17%)
WD40 repeat 1799..1836 CDD:293791 8/49 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.