| Sequence 1: | NP_001245503.1 | Gene: | wds / 53428 | FlyBaseID: | FBgn0040066 | Length: | 361 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001259886.1 | Gene: | Wdr62 / 33367 | FlyBaseID: | FBgn0031374 | Length: | 2397 | Species: | Drosophila melanogaster |
| Alignment Length: | 355 | Identity: | 69/355 - (19%) |
|---|---|---|---|
| Similarity: | 125/355 - (35%) | Gaps: | 130/355 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 85 EWLASSSADKLIKIWG----------------------------------------------AYD 103
Fly 104 GKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQS 168
Fly 169 ---NLIVSGSFDESVRIWDV-RTGKCLKTLPAHSDPVSAVHF----------------------- 206
Fly 207 ---------NRDGSL-------------IVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKF 249
Fly 250 S--PNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKW------IVSGSE 306
Fly 307 DNMVYIW--------NLQSKEVVQKLQ-GH 327 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| wds | NP_001245503.1 | WD40 | 64..358 | CDD:238121 | 69/355 (19%) |
| WD40 repeat | 75..112 | CDD:293791 | 9/72 (13%) | ||
| WD40 repeat | 118..154 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 159..195 | CDD:293791 | 10/39 (26%) | ||
| WD40 repeat | 202..237 | CDD:293791 | 9/79 (11%) | ||
| WD40 repeat | 244..280 | CDD:293791 | 12/37 (32%) | ||
| WD40 repeat | 288..325 | CDD:293791 | 11/50 (22%) | ||
| WD40 repeat | 331..357 | CDD:293791 | |||
| Wdr62 | NP_001259886.1 | WD40 | 73..448 | CDD:295369 | 4/13 (31%) |
| WD40 repeat | 73..107 | CDD:293791 | |||
| WD40 repeat | 113..161 | CDD:293791 | |||
| WD40 | 158..574 | CDD:225201 | 25/148 (17%) | ||
| WD40 repeat | 167..207 | CDD:293791 | |||
| WD40 repeat | 209..285 | CDD:293791 | |||
| WD40 repeat | 254..294 | CDD:293791 | |||
| WD40 repeat | 303..338 | CDD:293791 | |||
| WD40 repeat | 353..407 | CDD:293791 | |||
| WD40 | 385..747 | CDD:225201 | 62/330 (19%) | ||
| WD40 | 436..748 | CDD:295369 | 62/329 (19%) | ||
| WD40 repeat | 505..540 | CDD:293791 | 8/34 (24%) | ||
| WD40 repeat | 546..586 | CDD:293791 | 10/39 (26%) | ||
| WD40 repeat | 591..631 | CDD:293791 | 2/39 (5%) | ||
| WD40 repeat | 637..672 | CDD:293791 | 6/34 (18%) | ||
| WD40 repeat | 679..717 | CDD:293791 | 12/37 (32%) | ||
| WD40 repeat | 723..749 | CDD:293791 | 9/25 (36%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45442350 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||