DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and CG12608

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_573019.1 Gene:CG12608 / 32463 FlyBaseID:FBgn0030630 Length:443 Species:Drosophila melanogaster


Alignment Length:313 Identity:65/313 - (20%)
Similarity:117/313 - (37%) Gaps:89/313 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKV-WELSTGKSLKTLKGHSNYVFCCNFNPQ 167
            |.:|:.:.|.|             |:.|.:|..|..| :||.     :|....|:.....:...|
  Fly    10 GTYEEVLLGFK-------------LIKSPTDGLTDSVKFELK-----QTFADSSHAGSITSVAVQ 56

  Fly   168 SNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDG---LCRI----- 224
            ...:.||..|:.:.::|:||.|..:.:.:|:..|:.:.|..|.|.::|.|.||   ..|:     
  Fly    57 WPWVASGGTDDRIFVYDMRTRKQSQIILSHAGRVNTLKFTPDLSHLLSGSDDGHMIATRVGSWTK 121

  Fly   225 ---WDTA-SGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGK-CLKTYTGHKN 284
               |..| :||.           |:.:...|:.|..|:...|..|..|:...|: ..||...:|.
  Fly   122 EGDWQKAHAGQA-----------VTHISCHPSSKLALSLGGDQVLNTWNLVNGRVAYKTNLKNKA 175

  Fly   285 ----EKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTE----- 340
                :..|:  ::|..|..:.:||  ..::.||.:::..|:::::.....:..|.....|     
  Fly   176 TLGLQPGCL--SWSKQGDHFTLSG--PLVLEIWGIENAHVMRRIEMPAKPICITWLDGNECLTGL 236

  Fly   341 ---NIIASAALENDKT------------------------------IKLWKSD 360
               ||...:..:.|.|                              ||:||.|
  Fly   237 DNGNIAWISLKDEDDTPPTFILAHEARVKAIAYLNELLATVSSAGEIKVWKID 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 62/309 (20%)
WD40 repeat 75..112 CDD:293791 2/7 (29%)
WD40 repeat 118..154 CDD:293791 8/36 (22%)
WD40 repeat 159..195 CDD:293791 8/35 (23%)
WD40 repeat 202..237 CDD:293791 12/46 (26%)
WD40 repeat 244..280 CDD:293791 10/36 (28%)
WD40 repeat 288..325 CDD:293791 8/36 (22%)
WD40 repeat 331..357 CDD:293791 8/63 (13%)
CG12608NP_573019.1 WD40 33..>289 CDD:225201 56/275 (20%)
WD40 45..295 CDD:295369 53/260 (20%)
WD40 repeat 51..85 CDD:293791 8/33 (24%)
WD40 repeat 90..128 CDD:293791 10/37 (27%)
WD40 repeat 135..170 CDD:293791 8/34 (24%)
WD40 repeat 181..214 CDD:293791 8/36 (22%)
WD40 repeat 264..286 CDD:293791 2/21 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442338
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.