DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and Rbcn-3B

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001284797.1 Gene:Rbcn-3B / 31155 FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster


Alignment Length:359 Identity:79/359 - (22%)
Similarity:124/359 - (34%) Gaps:118/359 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 IKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLK-----TLKGH 155
            :.:||       .|...|  .||.|..|.|...||:|..|..:.:|::.. .:||     .|.||
  Fly    10 VVLWG-------PTAPTH--CISSVFLSDDQFTLVTGCYDGQICLWQVEP-TTLKMSPRCLLVGH 64

  Fly   156 SNYVFC---CNFNPQSNLIVSGSFDESVRIWDVRTGKCLKT--LPAHSDPVSAVH-FNRDGSLIV 214
            |..|.|   .:..|::|.:||.|.:..:..||:..|||::.  ||.....:.:.| .|.:...:.
  Fly    65 SAPVLCLVRASLLPENNFLVSSSENGEMCTWDLTDGKCMEAVKLPQVHTQIQSYHTANSEDVRLF 129

  Fly   215 SSSYDGLCRIWDTASGQCLKTLIDDDNPP-VSFV----KFSPNGKYILAATLDNTLKLWDYSKGK 274
            ...|.....:.|..|.:.:..|.....|. :|.:    ........:||.|...|:|:|      
  Fly   130 CIGYYAEIMVMDPFSLEVIYVLSSKVKPDWISAIHVLRPMRRKDDVVLAITTTGTVKVW------ 188

  Fly   275 CLKTYTGHKN------------EKYCIFA---------------------------NFSV----- 295
               |.||::|            |..|:.|                           :|:|     
  Fly   189 ---TLTGNENKHAEPIYENESKEIRCLNAITMNCCAQNQRTVLLVCTKYWQIYDAGDFTVLCSVI 250

  Fly   296 -------TGGKWIVSG-----SEDNMVYIWNL-----------QSKEVVQK-------LQGHTDT 330
                   .||.:|.|.     :::...|::.|           .||.||:.       ||...|.
  Fly   251 APARERWQGGDFITSDRVMLWTDEGKGYLYKLPANCIPDNKEFHSKSVVRDAPYLYYVLQHAGDK 315

  Fly   331 VLCTACHPTENIIASAA-----LENDKT--IKLW 357
            ||  :|.|...::..|.     |..|..  |.:|
  Fly   316 VL--SCPPAMKLLQGAGGQHNLLRGDSEGYISVW 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 79/359 (22%)
WD40 repeat 75..112 CDD:293791 3/15 (20%)
WD40 repeat 118..154 CDD:293791 12/40 (30%)
WD40 repeat 159..195 CDD:293791 12/40 (30%)
WD40 repeat 202..237 CDD:293791 5/35 (14%)
WD40 repeat 244..280 CDD:293791 8/39 (21%)
WD40 repeat 288..325 CDD:293791 14/98 (14%)
WD40 repeat 331..357 CDD:293791 8/32 (25%)
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201 52/211 (25%)
WD40 repeat 20..63 CDD:293791 14/45 (31%)
WD40 <22..202 CDD:295369 48/189 (25%)
WD40 repeat 68..107 CDD:293791 12/38 (32%)
WD40 repeat 118..152 CDD:293791 5/33 (15%)
WD40 repeat 160..204 CDD:293791 11/52 (21%)
WD40 repeat 212..251 CDD:293791 3/38 (8%)
WD40 repeat 406..459 CDD:293791
WD40 <449..>607 CDD:225201
WD40 453..>597 CDD:295369
WD40 repeat 513..555 CDD:293791
WD40 repeat 560..596 CDD:293791
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.