Sequence 1: | NP_001245503.1 | Gene: | wds / 53428 | FlyBaseID: | FBgn0040066 | Length: | 361 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001094438.2 | Gene: | Cfap52 / 303233 | RGDID: | 1308151 | Length: | 620 | Species: | Rattus norvegicus |
Alignment Length: | 258 | Identity: | 62/258 - (24%) |
---|---|---|---|
Similarity: | 118/258 - (45%) | Gaps: | 19/258 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 LKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTI-SGHKLGISDVAWSSDSR 127
Fly 128 LLVSGSDDKTLKVWEL--STGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWD---VRT 187
Fly 188 GKCL--KTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFS 250
Fly 251 PNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIW 313 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
wds | NP_001245503.1 | WD40 | 64..358 | CDD:238121 | 62/258 (24%) |
WD40 repeat | 75..112 | CDD:293791 | 8/37 (22%) | ||
WD40 repeat | 118..154 | CDD:293791 | 10/37 (27%) | ||
WD40 repeat | 159..195 | CDD:293791 | 10/40 (25%) | ||
WD40 repeat | 202..237 | CDD:293791 | 6/34 (18%) | ||
WD40 repeat | 244..280 | CDD:293791 | 8/35 (23%) | ||
WD40 repeat | 288..325 | CDD:293791 | 8/26 (31%) | ||
WD40 repeat | 331..357 | CDD:293791 | |||
Cfap52 | NP_001094438.2 | WD40 | 9..399 | CDD:225201 | 7/32 (22%) |
WD40 | 30..399 | CDD:295369 | 7/32 (22%) | ||
WD40 repeat | 67..108 | CDD:293791 | |||
WD40 repeat | 115..157 | CDD:293791 | |||
WD40 repeat | 162..199 | CDD:293791 | |||
WD40 repeat | 205..302 | CDD:293791 | |||
WD40 repeat | 253..307 | CDD:293791 | |||
WD40 | 277..617 | CDD:225201 | 62/258 (24%) | ||
WD40 | 346..615 | CDD:295369 | 62/258 (24%) | ||
WD40 repeat | 380..414 | CDD:293791 | 8/33 (24%) | ||
WD40 repeat | 421..459 | CDD:293791 | 10/37 (27%) | ||
WD40 repeat | 464..492 | CDD:293791 | 8/27 (30%) | ||
WD40 repeat | 500..541 | CDD:293791 | 8/46 (17%) | ||
WD40 repeat | 548..584 | CDD:293791 | 8/35 (23%) | ||
WD40 repeat | 590..616 | CDD:293791 | 8/25 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |