DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and POC1B

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_758440.1 Gene:POC1B / 282809 HGNCID:30836 Length:478 Species:Homo sapiens


Alignment Length:298 Identity:91/298 - (30%)
Similarity:151/298 - (50%) Gaps:24/298 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GQPGATTSSNSSASNKSSLSV-----------KPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSS 91
            |...|.||.:.|.:.|...:.           || :...:...||...|::|:|||:|..|||:|
Human    16 GHKAAITSLDLSPNGKQLATASWDTFLMLWNFKP-HARAYRYVGHKDVVTSVQFSPHGNLLASAS 79

  Fly    92 ADKLIKIW-GAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGH 155
            .|:.:::| ....|||.: ...|...:..|.:|:|.:.|.:.|:||::|||.:...:.|.:|..|
Human    80 RDRTVRLWIPDKRGKFSE-FKAHTAPVRSVDFSADGQFLATASEDKSIKVWSMYRQRFLYSLYRH 143

  Fly   156 SNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPV---SAVHFNRDGSLIVSSS 217
            :::|.|..|:|...||||.|.|::::|||....:|:...   ||.|   :.|.||..|:.|.|:.
Human   144 THWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNF---SDSVGFANFVDFNPSGTCIASAG 205

  Fly   218 YDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 282
            .|...::||....:.|:. ....:..|:.:.|.|:|.|::.|:.|.|||:.|..:|:.:.|..||
Human   206 SDQTVKVWDVRVNKLLQH-YQVHSGGVNCISFHPSGNYLITASSDGTLKILDLLEGRLIYTLQGH 269

  Fly   283 KNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEV 320
            ....:.:  :|| .||:...||..|..|.:|.....|:
Human   270 TGPVFTV--SFS-KGGELFASGGADTQVLLWRTNFDEL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 83/261 (32%)
WD40 repeat 75..112 CDD:293791 15/37 (41%)
WD40 repeat 118..154 CDD:293791 12/35 (34%)
WD40 repeat 159..195 CDD:293791 14/35 (40%)
WD40 repeat 202..237 CDD:293791 10/34 (29%)
WD40 repeat 244..280 CDD:293791 13/35 (37%)
WD40 repeat 288..325 CDD:293791 10/33 (30%)
WD40 repeat 331..357 CDD:293791
POC1BNP_758440.1 WD40 10..298 CDD:238121 89/290 (31%)
WD 1 16..55 8/39 (21%)
WD40 repeat 21..58 CDD:293791 6/37 (16%)
WD 2 58..99 17/41 (41%)
WD40 repeat 63..100 CDD:293791 15/37 (41%)
WD 3 101..139 12/37 (32%)
WD40 repeat 106..142 CDD:293791 12/35 (34%)
WD 4 142..181 15/38 (39%)
WD40 repeat 147..182 CDD:293791 14/34 (41%)
WD 5 183..223 13/39 (33%)
WD40 repeat 190..225 CDD:293791 10/35 (29%)
WD 6 226..265 12/38 (32%)
WD40 repeat 231..267 CDD:293791 13/35 (37%)
WD 7 268..307 12/40 (30%)
WD40 repeat 273..299 CDD:293791 9/28 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.