DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and tup12

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_592910.2 Gene:tup12 / 2543402 PomBaseID:SPAC630.14c Length:598 Species:Schizosaccharomyces pombe


Alignment Length:390 Identity:120/390 - (30%)
Similarity:193/390 - (49%) Gaps:63/390 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GHP--------GVVHPPQQPL---------PTAPSG--PNSLQPNSVGQPGATTSSNSSASNKS- 54
            |||        ..|.|...||         |..|:.  |.|..||...:....|   |:..||. 
pombe   225 GHPPPPSDSANSSVTPIAAPLVVNGKVSGNPPYPAEIIPTSNVPNREEKDWTVT---SNVPNKEP 286

  Fly    55 SLSVKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKF------EKTISGH 113
            .:||:..:||:     ||..:..|:||.:|::|| :..::...::....||.      |.:....
pombe   287 PISVQLLHTLE-----HTSVICYVRFSADGKFLA-TGCNRAAMVFNVETGKLITLLQEESSKREG 345

  Fly   114 KLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDE 178
            .|.:..||:|.|.:.|.:|.:|:.:::|:::..:..:.|.||...::..:|:.....:||||.|.
pombe   346 DLYVRSVAFSPDGKYLATGVEDQQIRIWDIAQKRVYRLLTGHEQEIYSLDFSKDGKTLVSGSGDR 410

  Fly   179 SVRIWDVRTGKCLKTLPAHSDP-VSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNP 242
            :|.:|||..|:  :.|..|:|. |:.|.|:.||..|.:.|.|.:.||| |:||..::.|...:..
pombe   411 TVCLWDVEAGE--QKLILHTDDGVTTVMFSPDGQFIAAGSLDKVIRIW-TSSGTLVEQLHGHEES 472

  Fly   243 PVSFVKFSPNGKYILAATLDNTLKLWD-----------YSKGK-CLKTYTGHKNEKYCIFANFSV 295
            ..| |.|||:|||:::.:||||:|||:           |.:|. |.:|:||||:     |. .||
pombe   473 VYS-VAFSPDGKYLVSGSLDNTIKLWELQCVSNVAPSMYKEGGICKQTFTGHKD-----FI-LSV 530

  Fly   296 T---GGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLW 357
            |   .||||:|||:|..:..|:..|......||||.::|:..|..|..:..|:.:  .|...::|
pombe   531 TVSPDGKWIISGSKDRTIQFWSPDSPHSQLTLQGHNNSVISVAVSPNGHCFATGS--GDLRARIW 593

  Fly   358  357
            pombe   594  593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 100/316 (32%)
WD40 repeat 75..112 CDD:293791 9/42 (21%)
WD40 repeat 118..154 CDD:293791 9/35 (26%)
WD40 repeat 159..195 CDD:293791 11/35 (31%)
WD40 repeat 202..237 CDD:293791 13/34 (38%)
WD40 repeat 244..280 CDD:293791 19/47 (40%)
WD40 repeat 288..325 CDD:293791 14/39 (36%)
WD40 repeat 331..357 CDD:293791 5/25 (20%)
tup12NP_592910.2 Tup_N 37..115 CDD:285748
WD40 <284..598 CDD:225201 104/328 (32%)
WD40 292..594 CDD:238121 101/320 (32%)
WD40 repeat 302..338 CDD:293791 8/36 (22%)
WD40 repeat 350..386 CDD:293791 9/35 (26%)
WD40 repeat 391..426 CDD:293791 12/36 (33%)
WD40 repeat 433..467 CDD:293791 13/34 (38%)
WD40 repeat 473..521 CDD:293791 19/48 (40%)
WD40 repeat 527..563 CDD:293791 13/36 (36%)
WD40 repeat 569..593 CDD:293791 5/25 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.