DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and tup11

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_592873.1 Gene:tup11 / 2542299 PomBaseID:SPAC18B11.10 Length:614 Species:Schizosaccharomyces pombe


Alignment Length:395 Identity:111/395 - (28%)
Similarity:182/395 - (46%) Gaps:58/395 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PGV-VHPPQQPLPTAPSGPNSL----QPNSVGQPG-----------ATTSSNSSASNKSS----L 56
            |.| |.||:.|....||...|:    ...|:.|.|           |..|...:|...:|    :
pombe   228 PAVNVQPPRIPTKATPSAEPSMTASANAGSISQAGPDGEYQGREQIAPVSDTEAARKTTSQSWYV 292

  Fly    57 SVKP------NYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHK- 114
            :..|      |..|..||. |...|..||||.||::|| :..::...::....||  |..:.|: 
pombe   293 TYNPACKRVFNINLVHTLE-HPSVVCCVKFSNNGKYLA-TGCNQAANVFDVQTGK--KLFTLHEE 353

  Fly   115 -------LGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIV 172
                   |.:..:|:|.|.:.||:|::|:.:|:|:|||.|......||...::..:|:.....||
pombe   354 SPDPSRDLYVRTIAFSPDGKYLVTGTEDRQIKLWDLSTQKVRYVFSGHEQDIYSLDFSHNGRFIV 418

  Fly   173 SGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI 237
            |||.|.:.|:|||.||:|:..|...:. |:|:..:.:...|...|.|.:.|:| :.||..::.| 
pombe   419 SGSGDRTARLWDVETGQCILKLEIENG-VTAIAISPNDQFIAVGSLDQIIRVW-SVSGTLVERL- 480

  Fly   238 DDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYS------------KGKCLKTYTGHKNEKYCIF 290
            :.....|..:.|||:...:|:.:||.|:|:|:..            :|.|..|||||.:....:.
pombe   481 EGHKESVYSIAFSPDSSILLSGSLDKTIKVWELQATRSVGLSAIKPEGICKATYTGHTDFVLSVA 545

  Fly   291 ANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIK 355
            .:   ...:|.:|||:|..:..|:||:.:.....|||.::|:.....|.....||.:  .|...:
pombe   546 VS---PDSRWGLSGSKDRSMQFWDLQTGQSYLTCQGHKNSVISVCFSPDGRQFASGS--GDLRAR 605

  Fly   356 LWKSD 360
            :|..|
pombe   606 IWSID 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 91/313 (29%)
WD40 repeat 75..112 CDD:293791 12/36 (33%)
WD40 repeat 118..154 CDD:293791 13/35 (37%)
WD40 repeat 159..195 CDD:293791 14/35 (40%)
WD40 repeat 202..237 CDD:293791 8/34 (24%)
WD40 repeat 244..280 CDD:293791 13/47 (28%)
WD40 repeat 288..325 CDD:293791 8/36 (22%)
WD40 repeat 331..357 CDD:293791 5/25 (20%)
tup11NP_592873.1 Tup_N 9..86 CDD:285748
WD40 <303..610 CDD:225201 93/318 (29%)
WD40 306..608 CDD:238121 91/313 (29%)
WD40 repeat 316..358 CDD:293791 13/44 (30%)
WD40 repeat 364..400 CDD:293791 13/35 (37%)
WD40 repeat 405..441 CDD:293791 14/35 (40%)
WD40 repeat 447..481 CDD:293791 9/35 (26%)
WD40 repeat 487..535 CDD:293791 13/47 (28%)
WD40 repeat 541..577 CDD:293791 8/38 (21%)
WD40 repeat 583..607 CDD:293791 5/25 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.