DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and spt8

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_595920.1 Gene:spt8 / 2539775 PomBaseID:SPBC14C8.17c Length:526 Species:Schizosaccharomyces pombe


Alignment Length:403 Identity:82/403 - (20%)
Similarity:139/403 - (34%) Gaps:144/403 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ASNKSSLSVKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADK-------------------- 94
            ||..|...|.|  ||...:|   .:::|..|:.:.:||.:...|.                    
pombe   101 ASTASFYDVVP--TLAIPMA---TSINAFAFTSDLKWLFTGGEDGYIRKYDFFPSINGDLSLTVA 160

  Fly    95 --------------LIKIW-GAYDGKFEKTI---SGHKLGISDVAWSSDSRLLVSGSDDKTLKVW 141
                          |:..| .||||....::   :.|..|:    |      ::||.::..:.::
pombe   161 QRHPFVDTVTKAGILLNYWENAYDGNKPSSVYSLAAHSRGL----W------VLSGVNNGDIILY 215

  Fly   142 EL--STGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAV 204
            ..  ..|..:.:||.|:..|.|...:.....::|||:|:.|..||:.||..:.|....|..:|.:
pombe   216 STRHQEGYPVTSLKKHTAPVSCLALHGSEKKVLSGSWDKMVYYWDLNTGDAISTYNCESGQISNI 280

  Fly   205 HFNRDGSL-----------------IVSSSYDGLCRIWD----------TASGQC---------- 232
            .:...|::                 ..|||||.|   :|          |.|.|.          
pombe   281 VYRPSGAVNPWGSESDDMRSLFGTPASSSSYDAL---FDEEVEKAIEEETKSVQANEENETEKPS 342

  Fly   233 -LKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDY-----------SKG-------KCL-- 276
             .::..::||........|......|..::|..:.:||:           .||       .|.  
pombe   343 QTESTTNNDNIKAPSESSSEESNIFLTTSIDGVMNVWDHRMVDSVLKYPVPKGVPPWAMSACWSP 407

  Fly   277 ---KTYTGHKN---EKYCIFAN-------------------FSVTGGKWIVSGSEDNMVYIWNLQ 316
               ..|.|.:|   |:|.|.:.                   :|:..|:.:|..|.|| :.:::||
pombe   408 DGNNIYIGRRNGIVEEYNIHSGKEPVRSLKMPLDSGPVSNVYSMPNGRHLVISSFDN-IRLYDLQ 471

  Fly   317 SKEVVQKL--QGH 327
            ||..:..|  .||
pombe   472 SKAGIGFLIIPGH 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 76/389 (20%)
WD40 repeat 75..112 CDD:293791 11/74 (15%)
WD40 repeat 118..154 CDD:293791 5/37 (14%)
WD40 repeat 159..195 CDD:293791 12/35 (34%)
WD40 repeat 202..237 CDD:293791 12/72 (17%)
WD40 repeat 244..280 CDD:293791 8/58 (14%)
WD40 repeat 288..325 CDD:293791 12/57 (21%)
WD40 repeat 331..357 CDD:293791
spt8NP_595920.1 SDA1 <35..>95 CDD:283052
WD40 120..473 CDD:225201 69/366 (19%)
WD40 120..469 CDD:295369 67/362 (19%)
WD40 repeat 121..161 CDD:293791 5/39 (13%)
WD40 repeat 167..230 CDD:293791 13/72 (18%)
WD40 repeat 235..271 CDD:293791 12/35 (34%)
WD40 repeat 299..393 CDD:293791 17/96 (18%)
WD40 repeat 400..437 CDD:293791 7/36 (19%)
WD40 repeat 445..482 CDD:293791 11/37 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.