DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and Nle1

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_663406.2 Gene:Nle1 / 217011 MGIID:2429770 Length:485 Species:Mus musculus


Alignment Length:416 Identity:104/416 - (25%)
Similarity:170/416 - (40%) Gaps:114/416 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QPNSVGQPGATTSSNSSASNKSSLSVKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIK 97
            ||.:|.:..|.|...||                  |.||::||.:|.|||.|::|||.|.|..::
Mouse    93 QPQAVFRVRAVTRCTSS------------------LEGHSEAVISVAFSPTGKYLASGSGDTTVR 139

  Fly    98 IWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSL-KTLKGHSNYVFC 161
            .|.........|..||:..:..::||.|.:.|.||..:..:.:|:.|||..: :||.|||.::..
Mouse   140 FWDLSTETPHFTCKGHRHWVLSISWSPDGKKLASGCKNGQVLLWDPSTGLQVGRTLTGHSKWITG 204

  Fly   162 CNF-----NPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGL 221
            .::     ||:...:.|.|.|.|||:||...|:|.:.|..|:..|:.:.:..|| |:.|:|.|..
Mouse   205 LSWEPLHMNPECRYVASSSKDGSVRVWDTTAGRCERILTGHTQSVTCLRWGGDG-LLYSASQDRT 268

  Fly   222 CRIWDTASGQCLKTL-------------------------------------------------- 236
            .::|....|...:||                                                  
Mouse   269 IKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEATVNAQDLQGSLKELKERASSRY 333

  Fly   237 --------------IDD----------DNPP----------VSFVKFSPNGKYILAATLDNTLKL 267
                          .||          |..|          ::.|.|||:.:.:.:|:.|.::||
Mouse   334 NLVRGQGPERLVSGSDDFTLFLWSPAEDKKPLARMTGHQALINQVLFSPDSRIVASASFDKSIKL 398

  Fly   268 WDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVL 332
            ||...||.|.:..||....|.|..:   ...:.:||||.|:.:.:|:::::::...|.||.|.|.
Mouse   399 WDGRTGKYLASLRGHVAAVYQIAWS---ADSRLLVSGSSDSTLKVWDVKAQKLATDLPGHADEVY 460

  Fly   333 CTACHPTENIIASAALENDKTIKLWK 358
            .....|....:||..  .||.:::|:
Mouse   461 AVDWSPDGQRVASGG--KDKCLRIWR 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 96/383 (25%)
WD40 repeat 75..112 CDD:293791 13/36 (36%)
WD40 repeat 118..154 CDD:293791 12/36 (33%)
WD40 repeat 159..195 CDD:293791 12/40 (30%)
WD40 repeat 202..237 CDD:293791 10/98 (10%)
WD40 repeat 244..280 CDD:293791 13/35 (37%)
WD40 repeat 288..325 CDD:293791 7/36 (19%)
WD40 repeat 331..357 CDD:293791 6/25 (24%)
Nle1NP_663406.2 NLE 17..77 CDD:285380
WD40 106..484 CDD:238121 98/401 (24%)
WD40 107..485 CDD:225201 99/402 (25%)
WD 1 112..151 15/38 (39%)
WD 2 154..193 12/38 (32%)
WD40 repeat 159..197 CDD:293791 12/37 (32%)
WD 3 197..241 15/43 (35%)
WD40 repeat 203..244 CDD:293791 13/40 (33%)
WD 4 244..282 10/38 (26%)
WD40 repeat 249..284 CDD:293791 10/35 (29%)
WD40 repeat 291..369 CDD:293791 4/77 (5%)
WD 5 327..366 4/38 (11%)
WD 6 370..409 13/38 (34%)
WD40 repeat 375..411 CDD:293791 13/35 (37%)
WD 7 412..451 10/41 (24%)
WD40 repeat 417..453 CDD:293791 8/38 (21%)
WD 8 454..484 9/31 (29%)
WD40 repeat 459..483 CDD:293791 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.