| Sequence 1: | NP_001245503.1 | Gene: | wds / 53428 | FlyBaseID: | FBgn0040066 | Length: | 361 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_663371.2 | Gene: | Tbl3 / 213773 | MGIID: | 2384863 | Length: | 801 | Species: | Mus musculus |
| Alignment Length: | 343 | Identity: | 84/343 - (24%) |
|---|---|---|---|
| Similarity: | 140/343 - (40%) | Gaps: | 66/343 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 75 VSAVKFSPNGEWLASSSADKLIKIWGAYDG---KFEKTISGHKLGISDVAWSSDSRLLVSGSDDK 136
Fly 137 TLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSN--LIVSGSFDESVRIWDVRTGKCLKTLPAHSD 199
Fly 200 PVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKT-----------LIDDDNPPVSFVKFSPNG 253
Fly 254 KYILAATLDNTLKLWDYSKGKCLKT----------------------------------YTGHKN 284
Fly 285 EKYCIFANFSV---------TGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTE 340
Fly 341 NIIASAALENDKTIKLWK 358 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| wds | NP_001245503.1 | WD40 | 64..358 | CDD:238121 | 82/341 (24%) |
| WD40 repeat | 75..112 | CDD:293791 | 10/39 (26%) | ||
| WD40 repeat | 118..154 | CDD:293791 | 8/35 (23%) | ||
| WD40 repeat | 159..195 | CDD:293791 | 11/37 (30%) | ||
| WD40 repeat | 202..237 | CDD:293791 | 11/45 (24%) | ||
| WD40 repeat | 244..280 | CDD:293791 | 11/69 (16%) | ||
| WD40 repeat | 288..325 | CDD:293791 | 9/45 (20%) | ||
| WD40 repeat | 331..357 | CDD:293791 | 7/25 (28%) | ||
| Tbl3 | NP_663371.2 | WD40 | 60..602 | CDD:225201 | 84/343 (24%) |
| WD 1 | 64..105 | 8/35 (23%) | |||
| WD40 repeat | 69..105 | CDD:293791 | 8/35 (23%) | ||
| WD 2 | 107..146 | 10/40 (25%) | |||
| WD40 | <108..137 | CDD:197651 | 8/28 (29%) | ||
| WD40 repeat | 112..149 | CDD:293791 | 8/36 (22%) | ||
| WD40 | 144..449 | CDD:238121 | 65/266 (24%) | ||
| WD 3 | 149..190 | 12/40 (30%) | |||
| WD40 repeat | 155..193 | CDD:293791 | 11/37 (30%) | ||
| WD 4 | 193..232 | 13/38 (34%) | |||
| WD40 repeat | 198..237 | CDD:293791 | 12/38 (32%) | ||
| WD40 repeat | 245..286 | CDD:293791 | 12/42 (29%) | ||
| WD 5 | 245..284 | 11/40 (28%) | |||
| WD 6 | 290..329 | 2/38 (5%) | |||
| WD40 | 328..633 | CDD:238121 | 23/80 (29%) | ||
| WD 7 | 332..372 | 7/40 (18%) | |||
| WD40 repeat | 338..374 | CDD:293791 | 7/36 (19%) | ||
| WD 8 | 374..413 | 13/33 (39%) | |||
| WD40 repeat | 379..418 | CDD:293791 | 9/28 (32%) | ||
| WD 9 | 419..459 | ||||
| WD40 repeat | 426..476 | CDD:293791 | |||
| WD 10 | 477..516 | ||||
| WD40 repeat | 482..518 | CDD:293791 | |||
| WD 11 | 519..560 | ||||
| WD40 repeat | 524..560 | CDD:293791 | |||
| WD 12 | 562..602 | ||||
| WD40 repeat | 566..590 | CDD:293791 | |||
| WD 13 | 604..642 | ||||
| WD40 repeat | 608..634 | CDD:293791 | |||
| Utp13 | 654..788 | CDD:285789 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1422 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.940 | |||||