DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and Y53C12B.1

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_496100.1 Gene:Y53C12B.1 / 190203 WormBaseID:WBGene00013143 Length:793 Species:Caenorhabditis elegans


Alignment Length:226 Identity:63/226 - (27%)
Similarity:107/226 - (47%) Gaps:15/226 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SNKSSLSVKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFE----KTIS 111
            :.|..:...|..|...|:..|.|.|:.|..|.:...:|:...|||:|:|.....|.:    .|:|
 Worm   456 AEKDFVEQLPKLTCSSTMVAHGKDVNCVDISESDALIATGGMDKLVKLWQVDTHKMQLGIAGTLS 520

  Fly   112 GHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSF 176
            ||:.|:.||.::.:|..|.|.|.|.|:|:|.:|....|:|:.|||..||...|....:.::|...
 Worm   521 GHRRGVGDVKFAKNSHKLASCSGDMTIKIWNISEKSCLQTISGHSCAVFRVIFARNDSQLISADS 585

  Fly   177 DESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDN 241
            ...::||.::|..|..::.||:|.:.::..|.:.|..|::..||...:|...:.:..|.   :||
 Worm   586 AGIIKIWTIKTADCECSIDAHTDKIWSLSKNHNESEFVTAGTDGRIVVWKDVTEEKQKA---EDN 647

  Fly   242 PPVSFVKFSPNGKYILAATLDNTLKLWDYSK 272
            .....::..        .||.|.|....||:
 Worm   648 KRREAIEQD--------QTLTNLLSQKRYSE 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 60/213 (28%)
WD40 repeat 75..112 CDD:293791 11/40 (28%)
WD40 repeat 118..154 CDD:293791 13/35 (37%)
WD40 repeat 159..195 CDD:293791 8/35 (23%)
WD40 repeat 202..237 CDD:293791 7/34 (21%)
WD40 repeat 244..280 CDD:293791 6/29 (21%)
WD40 repeat 288..325 CDD:293791
WD40 repeat 331..357 CDD:293791
Y53C12B.1NP_496100.1 WD40 <22..137 CDD:392136
WD40 repeat 22..58 CDD:293791
WD40 repeat 64..107 CDD:293791
WD40 100..441 CDD:238121
WD40 repeat 112..149 CDD:293791
WD40 repeat 153..192 CDD:293791
WD40 repeat 197..255 CDD:293791
WD40 312..635 CDD:238121 53/178 (30%)
WD40 repeat 322..358 CDD:293791
WD40 repeat 364..410 CDD:293791
WD40 repeat 415..474 CDD:293791 4/17 (24%)
WD40 repeat 481..520 CDD:293791 10/38 (26%)
WD40 repeat 526..562 CDD:293791 13/35 (37%)
WD40 repeat 568..604 CDD:293791 8/35 (23%)
WD40 repeat 610..634 CDD:293791 5/23 (22%)
Utp13 656..789 CDD:370012 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1422
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.