Sequence 1: | NP_001245503.1 | Gene: | wds / 53428 | FlyBaseID: | FBgn0040066 | Length: | 361 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496100.1 | Gene: | Y53C12B.1 / 190203 | WormBaseID: | WBGene00013143 | Length: | 793 | Species: | Caenorhabditis elegans |
Alignment Length: | 226 | Identity: | 63/226 - (27%) |
---|---|---|---|
Similarity: | 107/226 - (47%) | Gaps: | 15/226 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 SNKSSLSVKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFE----KTIS 111
Fly 112 GHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSF 176
Fly 177 DESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDN 241
Fly 242 PPVSFVKFSPNGKYILAATLDNTLKLWDYSK 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
wds | NP_001245503.1 | WD40 | 64..358 | CDD:238121 | 60/213 (28%) |
WD40 repeat | 75..112 | CDD:293791 | 11/40 (28%) | ||
WD40 repeat | 118..154 | CDD:293791 | 13/35 (37%) | ||
WD40 repeat | 159..195 | CDD:293791 | 8/35 (23%) | ||
WD40 repeat | 202..237 | CDD:293791 | 7/34 (21%) | ||
WD40 repeat | 244..280 | CDD:293791 | 6/29 (21%) | ||
WD40 repeat | 288..325 | CDD:293791 | |||
WD40 repeat | 331..357 | CDD:293791 | |||
Y53C12B.1 | NP_496100.1 | WD40 | <22..137 | CDD:392136 | |
WD40 repeat | 22..58 | CDD:293791 | |||
WD40 repeat | 64..107 | CDD:293791 | |||
WD40 | 100..441 | CDD:238121 | |||
WD40 repeat | 112..149 | CDD:293791 | |||
WD40 repeat | 153..192 | CDD:293791 | |||
WD40 repeat | 197..255 | CDD:293791 | |||
WD40 | 312..635 | CDD:238121 | 53/178 (30%) | ||
WD40 repeat | 322..358 | CDD:293791 | |||
WD40 repeat | 364..410 | CDD:293791 | |||
WD40 repeat | 415..474 | CDD:293791 | 4/17 (24%) | ||
WD40 repeat | 481..520 | CDD:293791 | 10/38 (26%) | ||
WD40 repeat | 526..562 | CDD:293791 | 13/35 (37%) | ||
WD40 repeat | 568..604 | CDD:293791 | 8/35 (23%) | ||
WD40 repeat | 610..634 | CDD:293791 | 5/23 (22%) | ||
Utp13 | 656..789 | CDD:370012 | 6/23 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1422 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |