DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and B0280.9

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_498555.1 Gene:B0280.9 / 175994 WormBaseID:WBGene00015104 Length:429 Species:Caenorhabditis elegans


Alignment Length:161 Identity:31/161 - (19%)
Similarity:68/161 - (42%) Gaps:29/161 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SVGQPGATTSSNSSASNKSSLSVKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWG 100
            ::|.||..:|.::             :|....:.|.|.|:     |.:|::.|:.|...::.::.
 Worm   281 NIGLPGTKSSQHT-------------FTDDGAVHGTTLAI-----SQHGDYFATGSDTGIVNVYS 327

  Fly   101 AYDGKFEK------TISGHKLGISDVAWSSDSRLLV--SGSDDKTLK---VWELSTGKSLKTLKG 154
            ..|.:...      .:|.....:|.:|::||::|:.  |...|..|:   |...:|.|:.....|
 Worm   328 GNDCRNSTNPRPLFNVSNLVTAVSSIAFNSDAQLMAICSNVKDNHLRLVHVASQTTFKNFPERNG 392

  Fly   155 HSNYVFCCNFNPQSNLIVSGSFDESVRIWDV 185
            ...:..|..|:|....:..|:.|..:.::::
 Worm   393 KVTHARCVEFSPNGGYMAVGNDDGRLHVFEI 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 26/133 (20%)
WD40 repeat 75..112 CDD:293791 5/42 (12%)
WD40 repeat 118..154 CDD:293791 11/40 (28%)
WD40 repeat 159..195 CDD:293791 5/27 (19%)
WD40 repeat 202..237 CDD:293791
WD40 repeat 244..280 CDD:293791
WD40 repeat 288..325 CDD:293791
WD40 repeat 331..357 CDD:293791
B0280.9NP_498555.1 WD40 <66..424 CDD:225201 31/161 (19%)
WD40 repeat 122..195 CDD:293791
WD40 167..423 CDD:295369 31/159 (19%)
WD40 repeat 168..207 CDD:293791
WD40 repeat 201..251 CDD:293791
WD40 repeat 258..296 CDD:293791 4/27 (15%)
WD40 repeat 303..343 CDD:293791 7/44 (16%)
WD40 repeat 350..388 CDD:293791 11/37 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.