DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and CFAP52

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_659491.4 Gene:CFAP52 / 146845 HGNCID:16053 Length:620 Species:Homo sapiens


Alignment Length:280 Identity:62/280 - (22%)
Similarity:123/280 - (43%) Gaps:41/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SASNKSSLSVK-PNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTI-S 111
            ::||:..|.:. ||.|           ...:.|..:|:.:.|:..|..|:.:....|:....| :
Human   361 TSSNRELLRITVPNMT-----------CHGIDFMRDGKSIISAWNDGKIRAFAPETGRLMYVINN 414

  Fly   112 GHKLGISDVAWSSDSRLLVSGSDDKTLKVWEL--STGKSLKTLKGHSNYVFCCNFNPQSNLIVSG 174
            .|::|::.:|.:||.:.::||..:..::||::  .|.|..:.||.|.:.|.|......:...|:.
Human   415 AHRIGVTAIATTSDCKRVISGGGEGEVRVWQIGCQTQKLEEALKEHKSSVSCIRVKRNNEECVTA 479

  Fly   175 SFDESVRIWD---VRTGKCL--KTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLK 234
            |.|.:..|||   :|..:.:  .||      ...|.::.:...|::|..|.....|:...|..::
Human   480 STDGTCIIWDLVRLRRNQMILANTL------FQCVCYHPEEFQIITSGTDRKIAYWEVFDGTVIR 538

  Fly   235 TLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVT--- 296
            .|....:..::.:..:..|.:.:....|:.:|:|||::|:......||..         ::|   
Human   539 ELEGSLSGSINGMDITQEGVHFVTGGNDHLVKVWDYNEGEVTHVGVGHSG---------NITRIR 594

  Fly   297 ---GGKWIVSGSEDNMVYIW 313
               |.::|||.|.|..:..|
Human   595 ISPGNQYIVSVSADGAILRW 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 56/264 (21%)
WD40 repeat 75..112 CDD:293791 7/37 (19%)
WD40 repeat 118..154 CDD:293791 10/37 (27%)
WD40 repeat 159..195 CDD:293791 10/40 (25%)
WD40 repeat 202..237 CDD:293791 6/34 (18%)
WD40 repeat 244..280 CDD:293791 7/35 (20%)
WD40 repeat 288..325 CDD:293791 8/32 (25%)
WD40 repeat 331..357 CDD:293791
CFAP52NP_659491.4 WD40 1..405 CDD:225201 11/54 (20%)
WD 1. /evidence=ECO:0000255 62..106
WD40 repeat 68..109 CDD:293791
WD40 100..141 CDD:197651
WD 2. /evidence=ECO:0000255 109..150
WD40 repeat 114..159 CDD:293791
WD 3. /evidence=ECO:0000255 156..195
WD40 repeat 166..201 CDD:293791
WD40 repeat 208..245 CDD:293791
WD40 repeat 253..307 CDD:293791
WD40 277..617 CDD:225201 62/280 (22%)
WD 4. /evidence=ECO:0000255 288..327
WD 5. /evidence=ECO:0000255 330..369 2/7 (29%)
WD40 346..615 CDD:295369 62/280 (22%)
WD 6. /evidence=ECO:0000255 372..411 9/49 (18%)
WD40 repeat 380..414 CDD:293791 7/33 (21%)
WD 7. /evidence=ECO:0000255 415..454 11/38 (29%)
WD40 repeat 420..459 CDD:293791 10/38 (26%)
WD 8. /evidence=ECO:0000255 459..498 10/38 (26%)
WD40 repeat 465..500 CDD:293791 8/34 (24%)
WD 9. /evidence=ECO:0000255 500..539 8/44 (18%)
WD40 repeat 505..541 CDD:293791 6/35 (17%)
WD 10. /evidence=ECO:0000255 543..582 7/38 (18%)
WD40 repeat 549..584 CDD:293791 7/34 (21%)
WD 11. /evidence=ECO:0000255 585..620 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.