DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and Wdr95

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_038945848.1 Gene:Wdr95 / 100361588 RGDID:1561029 Length:662 Species:Rattus norvegicus


Alignment Length:319 Identity:69/319 - (21%)
Similarity:124/319 - (38%) Gaps:78/319 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KAVSAVKFSPNGEWLASSSADKLIKIWGAY-DGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDK 136
            |.|.|..|......||:...|:::::|..| .||....:.||...:..|..:|:...:.|.|.|.
  Rat    27 KGVKAFSFCRKKNLLATGGLDRIVRVWNPYLPGKPTGVLRGHMAPVMYVHVASEENKVFSVSADN 91

  Fly   137 TLKVWELSTGKSLKT----------------------------------------------LKGH 155
            |:|:|:|.|.....|                                              |:.|
  Rat    92 TVKIWDLETHSCCCTVSSKASGIKGELTACLYLPGPRALCVATGTLALFHLKAGSVPEPHLLRSH 156

  Fly   156 SNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDG 220
            ...|.||.:||....:||......|::||:.||:.:.....::. ::.:.|:..|..:|:...||
  Rat   157 QEPVVCCRYNPAFRQVVSCCEASVVKVWDLETGRWVSEFIGNAG-ITCLAFDSSGRRLVTGGRDG 220

  Fly   221 LCRIWDTASGQCLKTLIDDDNP----PVSFVKFSPNGKYILAATLDNTLKLW-----DYSKGKCL 276
            ..:||...:|.||.||..|:|.    ..::::.:.|| .::|...|..:.::     |:...:..
  Rat   221 DLKIWSYNNGHCLHTLQHDENQNEVCDCTYMEVNRNG-CVIAVGWDRRINVYFDIPRDFHHFRKP 284

  Fly   277 KTY------TGHKNEKYCI-----FANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKL 324
            :.:      .|||.:..|:     |.         :.:.|.|..:.:||:.|..:..||
  Rat   285 QPHWQDDLNHGHKEDILCVAQCPPFL---------LATSSYDGEIIVWNVISGHMYCKL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 69/319 (22%)
WD40 repeat 75..112 CDD:293791 10/37 (27%)
WD40 repeat 118..154 CDD:293791 12/81 (15%)
WD40 repeat 159..195 CDD:293791 12/35 (34%)
WD40 repeat 202..237 CDD:293791 11/34 (32%)
WD40 repeat 244..280 CDD:293791 5/46 (11%)
WD40 repeat 288..325 CDD:293791 9/42 (21%)
WD40 repeat 331..357 CDD:293791
Wdr95XP_038945848.1 WD40 19..324 CDD:238121 64/307 (21%)
WD40 repeat 31..67 CDD:293791 9/35 (26%)
WD40 repeat 73..113 CDD:293791 11/39 (28%)
WD40 repeat 118..153 CDD:293791 0/34 (0%)
WD40 repeat 161..196 CDD:293791 11/34 (32%)
WD40 198..480 CDD:421866 31/148 (21%)
WD40 repeat 201..237 CDD:293791 11/35 (31%)
WD40 repeat 245..293 CDD:293791 5/48 (10%)
WD40 repeat 300..323 CDD:293791 4/31 (13%)
WD40 repeat 350..395 CDD:293791
WD40 repeat 403..446 CDD:293791
WD40 repeat 455..479 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.