DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wds and ambra1a

DIOPT Version :9

Sequence 1:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_002667715.3 Gene:ambra1a / 100332642 ZFINID:ZDB-GENE-111104-2 Length:1344 Species:Danio rerio


Alignment Length:147 Identity:40/147 - (27%)
Similarity:75/147 - (51%) Gaps:8/147 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 VAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNP-QSNLIVSGSFDESVRIW 183
            :|:|.|..|:.|...:..:.:.|:.:||.:.:|.||....:|..|:| ...||.||..|..||||
Zfish    58 LAFSPDRSLMASTHVNHNIYITEVKSGKCVHSLVGHRRTPWCLTFHPIIPGLIASGCLDGEVRIW 122

  Fly   184 DVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQ---CLKTLIDDDNPPVS 245
            |:..|. ...|...:..::::.|:....|::.::.:.: .:||.:..:   .:||..:.:.  |.
Zfish   123 DLHGGS-ESWLTESNSAIASLAFHPTAQLLLIATNNEV-HLWDWSRKEPFTVVKTASETER--VR 183

  Fly   246 FVKFSPNGKYILAATLD 262
            .|:|.|.|.|:|.|.::
Zfish   184 LVRFDPLGHYLLTAIVN 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wdsNP_001245503.1 WD40 64..358 CDD:238121 40/147 (27%)
WD40 repeat 75..112 CDD:293791
WD40 repeat 118..154 CDD:293791 9/33 (27%)
WD40 repeat 159..195 CDD:293791 14/36 (39%)
WD40 repeat 202..237 CDD:293791 6/37 (16%)
WD40 repeat 244..280 CDD:293791 8/19 (42%)
WD40 repeat 288..325 CDD:293791
WD40 repeat 331..357 CDD:293791
ambra1aXP_002667715.3 WD40 <43..>197 CDD:225201 39/142 (27%)
WD40 <58..197 CDD:295369 39/142 (27%)
WD40 repeat 58..91 CDD:293791 8/32 (25%)
WD40 repeat 98..134 CDD:293791 15/36 (42%)
WD40 repeat 139..175 CDD:293791 4/36 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.