DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXB and si:dkey-37g12.1

DIOPT Version :9

Sequence 1:NP_620474.2 Gene:ACXB / 53427 FlyBaseID:FBgn0040509 Length:1114 Species:Drosophila melanogaster
Sequence 2:XP_021333677.1 Gene:si:dkey-37g12.1 / 796669 ZFINID:ZDB-GENE-090312-145 Length:882 Species:Danio rerio


Alignment Length:288 Identity:73/288 - (25%)
Similarity:140/288 - (48%) Gaps:56/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 DISEVVHDLDTICVDI----------FHYLGFNLM-----GIFFRIMNDTMVRSSFLDRHQFLKE 242
            |.:|.|.:|:::.|..          |.|:...:.     |:...|::|.:.|   ::::....|
Zfish   593 DRAECVEELESLVVSCWRETPAERPDFSYIRTAIKKNSPHGVSENILDDLLSR---MEQYACNLE 654

  Fly   243 EM------WLRQARQQESMLLDSILPPQIAKPIQQSIKERIMLSETDSDRIVVNARRTENFMAIQ 301
            |:      .|::.:::...||..:||..:|   .|.|..:.:.:||                   
Zfish   655 EIVSERTAELQEEKKRAEGLLTQMLPRSVA---SQLIAGKTVRAET------------------- 697

  Fly   302 IHPDVSILYADVVNYTHLTTTLTVEKLVKVLHDLYGRFDMAASTFKVQRIKFLGDCYYCVAGL-- 364
             :..|:|.::|:..:|.::.:||..::|.||:|||..||.......|.:::.:||.|..|:||  
Zfish   698 -YDCVTIYFSDIEGFTAMSASLTPMQVVNVLNDLYTYFDNIIDYHNVYKVETIGDAYMVVSGLPI 761

  Fly   365 --GEADPDHARMAVSLGISMIANIQEVRAHRALD--IDMRIGVHSGTLLAGVIGQAKLQYDIWGP 425
              |:   |||:....:.::::..::...:....:  :.:|||||||..:|||:|....:|.::|.
Zfish   762 RNGD---DHAKEIARMSLAIVQGLRSFHSPHVPEQQLRVRIGVHSGPCVAGVVGLKMPRYCLFGD 823

  Fly   426 DVDIANRLEATGKPGYVHVSGRTLSSLN 453
            .|:.|:|:|:.|.|..:|||..|.|.|:
Zfish   824 TVNTASRMESYGLPLKIHVSSSTKSLLD 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXBNP_620474.2 AC_N <36..276 CDD:292831 21/103 (20%)
CYCc 249..459 CDD:214485 59/211 (28%)
Nucleotidyl_cyc_III 298..484 CDD:299850 50/162 (31%)
CYCc 825..1047 CDD:214485
Nucleotidyl_cyc_III 853..1072 CDD:299850
si:dkey-37g12.1XP_021333677.1 Periplasmic_Binding_Protein_Type_1 <59..258 CDD:324556
PKc_like 355..628 CDD:328722 7/34 (21%)
HNOBA <641..687 CDD:311573 10/51 (20%)
CYCc 666..850 CDD:214485 58/209 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.